KEGG   Bos indicus (zebu cattle): 109575848
Entry
109575848         CDS       T04792                                 

Gene name
IL5RA
Definition
(RefSeq) interleukin-5 receptor subunit alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109575848 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109575848 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109575848 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109575848 (IL5RA)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL3 receptor family
   109575848 (IL5RA)
CD molecules [BR:biu04090]
 Proteins
  109575848 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind Tissue_fac fn3 Il13Ra_Ig LIFR_D2 EpoR_lig-bind
Other DBs
NCBI-GeneID: 109575848
NCBI-ProteinID: XP_019839662
UniProt: A0A6P5DRL0
LinkDB
Position
22
AA seq 517 aa
MVIRNERINRRRQVVIIMAPELLILLGAAVILQADLLPDKKFLLLPPVNFTIKAVNLAQV
LLRWEPNPDQEQSNIQLGYHVKINAPQEEDYETRNTERNLITILHKGFSASVRTVPWNDH
SLQASSWVSAELKAPXGSPGTEIVNLTCTTNTKADNYTHLRPYQVSLHCTWLVGKDAPDD
TQYFLYYRYRSWIEECQEYSKDVLQRNVACWFPRTFINSKGRDYLAVYVNGSSKGAAIKP
FDQLFALHAIDRVNSPANVTAEIKGTCLSIHWEKPVSAFPSHCFDYEVKIYNAKKGYFQT
EKMTTNTLITIIDDVSKYYIQVRAAVSPVCRATGLWSEWSRPIYVGKDDQKPWTEWFLIA
VMMTICFXLLIFSLICRICHVWTKLFPPVPGPKSNINDFFVIINNESKHAEVENTALFIT
VCLTAGNACPNLVGLPSPGQLEPLLRTELPGAGTTPSAHVIHVPYFNVPMASFPHKDKSL
RQLPPHRLEEMQAHLRMKFIIHIFRPGGKMLFHTQVL
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggtcatcagaaatgagaggatcaaccgaaggagacaggttgtgatcatcatggcacct
gaattactgattcttttgggggcrgcagtaatactgcaagcagacttacttcctgataaa
aaatttttacttctaccaccagtcaatttcaccattaaagctgtcaatttagctcaagtt
cttttacgttgggaaccaaatcctgatcaagaacaaagcaatatccagctaggatatcat
gtgaaaataaatgctccacaagaagaagattacgaaaccaggaacactgaaagaaacctc
ataaccatccttcacaaaggcttttcagcgagtgtgcggacagtgccctggaacgaccac
tccctacaagccagcagctgggtttctgcagaacttaaagccccaayagggtctcctgga
actgagattgtgaatttaacttgcaccacaaacacgaaagcagataattacacacactta
cgaccataccaagtttctcttcactgcacctggcttgttggcaaggatgcccctgatgat
acacagtacttcctctactacaggtatcgctcttggattgaagaatgtcaggaatacagc
aaagacgtcctgcagagaaatgttgcctgctggtttcccaggactttcatcaatagcaaa
gggcgagactacctkgcagtgtatgttaacggctctagcaagggagctgcgatcaagcct
tttgatcagctctttgccctycatgccattgatcgagtaaattctccagcgaacgtcacg
gcagagatcaaaggaacctgtctctctatccactgggaaaaaccagtttctgcttttcca
agccactgcttcgattatgaggtgaaaatttacaatgcaaagaaaggatattttcagaca
gaaaaaatgacaaccaatacactcatcaccataattgatgatgtttctaagtattacatt
caagtgagagcagcagtgagccctgtgtgcagagcgacggggctctggagcgagtggagt
cggcccatttacgtggggaargatgatcagaagccctggacagagtggtttcttattgca
gttatgatgaccatctgcttcrtcttgttaattttctcactcatctgcagaatatgccac
gtatggaccaagttgtttccgcctgttccagggccgaagagtaatattaaygatttcttt
gtaatcatcaacaatgagtcgaaacatgccgaggttgagaacacggccctgtttatcacc
gtgtgcctaacagcagggaacgcctgccccaacctcgtgggcctaccttcacctgggcag
cttgagcccctgctgagaaccgagcttccgggagccggaaccaccccttcggctcacgtg
atccacgtgccttattttaatgttccaatggcctcttttccccataaagataaaagctta
aggcagctcccacctcacaggttggaagagatgcaagctcacctgaggatgaaatttatt
atccacatcttccgccccggtggaaagatgctgtttcatactcaggttttgtga

DBGET integrated database retrieval system