KEGG   Bos indicus (zebu cattle): 109575944
Entry
109575944         CDS       T04792                                 

Gene name
MLH1
Definition
(RefSeq) DNA mismatch repair protein Mlh1 isoform X1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu03430  Mismatch repair
biu03460  Fanconi anemia pathway
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05213  Endometrial cancer
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    109575944 (MLH1)
   03460 Fanconi anemia pathway
    109575944 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109575944 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109575944 (MLH1)
   05226 Gastric cancer
    109575944 (MLH1)
   05213 Endometrial cancer
    109575944 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109575944 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:biu03400]
    109575944 (MLH1)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     109575944 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 109575944
NCBI-ProteinID: XP_019839748
UniProt: A0A6P5DN02
LinkDB
Position
22
AA seq 758 aa
MSLVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLEIVCERFTTSKLQSFEDLAHISTYGFRGEALASISHVAHVTITTKTA
XGKCAYRAHYSDGKLKAPPKPCAGNQGTQITVEDLFYNISTRRKALKNPSEEYXKILEVV
GRYAVHNSGIGFSVKKQGETVADVRTLPNATTVDNIRSIFGNAVSRELIEVECEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESASLRKAIETVYAAYLPKSTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEDSILERLQQHIESRLLGSNASRTYFTQTLLPGLPGPSGEAV
KSTASVTSSSTAGSGDRVYAHQMVRTDCREQKLDAFLQPVSKALSSQPQAVVPEHRTDAS
SSGTRQQDXEMLELPAPAAVAAKSQALEDDATMRAADLAEKRGPSSSPENPRKRPREDSD
VEMVEDASRKEMTAACTPRRRIINLTSVLSLQEEINERGHETLREMLHNHSFVGCVNPQW
ALAQHQTKLYLLNTTRLSEELFYQILVYDFANFGVLRLSEPAPLFDLAMLALDSPESGWT
EEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLVGLPLLIDNYVPPLEGLPIFIL
RLATEVNWDEEKECFESLSKECAMFYSIRKQYVSAESTLSGQQSEVPGSTANPWKWTVEH
VIYKAFRSHLLPPKHFTEDGNILQLANLPDLYKVFERC
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgtcgcttgtagcgggggttatccggcggctggacgagacagtggtgaaccgcatcgcg
gcaggggaagttatccagcggccggctaatgccatcaaggaaatgattgagaactgttta
gatgcaaaatccacaagtattcaagtggtcgttaaagagggaggcctgaagttgattcag
attcaagacaatggcactgggatcaggaaagaagatcttgagattgtgtgtgagaggttc
accacaagtaaactgcagtcctttgaggatttagctcatatttctacctatggctttcgg
ggtgaggctctggccagcataagccacgtggctcacgtcaccattacaaccaaaacggct
gmcgggaagtgtgcatacagagctcattactcagatggaaagctgaaagcacctcctaaa
ccgtgtgcaggcaaccaagggacccagatcacggtggaagaccttttttacaacatatcc
acgaggaggaaagctttaaaaaacccaagtgaagagtatsgaaaaattttggaagttgtt
ggcaggtatgcagtacacaattcgggcattggtttctcagttaaaaaacaaggtgaaact
gtagctgacgtcaggaccctgccaaatgccaccaccgtggacaacattcgctccatcttt
ggaaatgctgttagccgagaattgatagaagttgaatgtgaggataaaacccttgccttc
aaaatgaatggctacatatccaatgcaaactattcagtgaagaagtgcatcttcttactc
ttcatcaaccatcgtctggtagagtcagcttccttaagaaaagccatagaaacggtgtat
gcagcgtatttgcccaaaagcacacacccgttcctgtacctcagtctagaaataagcccc
cagaatgtggatgtcaacgtgcaccccacgaagcacgaggttcacttcctgcatgaggac
agcatcctggaacggctgcagcagcacatcgagagcaggctcctgggctccaacgcctcc
aggacctacttcacccagactttactgccaggtcttcctggcccctctggggaagcagtt
aaatccacagcgagtgtgacatcctcatccactgctggaagtggtgacagagtgtatgcc
caccagatggtccgcacagactgccgggaacagaagctcgatgccttcctgcagcctgtg
agcaaggccctgtccagtcagccccaggctgtcgtcccagagcacaggacagatgcttct
agcagtgggaccaggcagcaggacraggagatgcttgaactcccagctcctgctgcagtg
gctgcgaagagtcaggccttagaggacgatgcaacaatgagggctgcagacctggccgag
aagagagggccctcttccagccccgagaaccccagaaagagacctcgggaagactctgat
gtggaaatggtggaggatgcatcccgaaaggagatgacagccgcttgtaccccccggaga
aggatcatcaaccttaccagtgttctgagtctccaggaggagatcaacgagcggggccat
gagactctccgggagatgctgcataaccactcctttgtgggctgcgtgaatcctcagtgg
gccttggcacagcatcagaccaagttataccttctcaacaccaccagacttagtgaagaa
ctgttctaccagattctcgtttatgattttgccaattttggtgttctgaggttatcggag
ccagcaccactctttgacctggccatgctcgccttagacagtcccgagagtggctggaca
gaggaggatggtcccaaggaaggacttgctgagtacattgttgagtttctgaaaaagaag
gctgagatgcttgcagactacttctctctggagattgatgaggaagggaacctggttgga
ttaccccttctgatcgacaactatgtgcccccgctggagggtctgcctatcttcatcctc
cgactggccacagaggtgaactgggatgaagaaaaggaatgttttgaaagcctcagtaaa
gaatgtgcgatgttttactccatccggaagcagtatgtgtctgcagagtcaaccctttca
ggccagcagagtgaagtgcctggctccactgcaaacccctggaagtggactgtggaacac
gtcatttataaagccttccgctcccacctgctgcctccaaaacacttcacagaagatggg
aacatcctgcagcttgctaacctgcctgatctctacaaagtcttcgagaggtgctga

DBGET integrated database retrieval system