KEGG   Bos indicus (zebu cattle): 109576048
Entry
109576048         CDS       T04792                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04072  Phospholipase D signaling pathway
biu04144  Endocytosis
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04520  Adherens junction
biu04540  Gap junction
biu04630  JAK-STAT signaling pathway
biu04810  Regulation of actin cytoskeleton
biu04912  GnRH signaling pathway
biu04915  Estrogen signaling pathway
biu04921  Oxytocin signaling pathway
biu04926  Relaxin signaling pathway
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu05160  Hepatitis C
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05171  Coronavirus disease - COVID-19
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05219  Bladder cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109576048 (EGFR)
   04012 ErbB signaling pathway
    109576048 (EGFR)
   04014 Ras signaling pathway
    109576048 (EGFR)
   04015 Rap1 signaling pathway
    109576048 (EGFR)
   04630 JAK-STAT signaling pathway
    109576048 (EGFR)
   04066 HIF-1 signaling pathway
    109576048 (EGFR)
   04068 FoxO signaling pathway
    109576048 (EGFR)
   04020 Calcium signaling pathway
    109576048 (EGFR)
   04072 Phospholipase D signaling pathway
    109576048 (EGFR)
   04151 PI3K-Akt signaling pathway
    109576048 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109576048 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109576048 (EGFR)
   04520 Adherens junction
    109576048 (EGFR)
   04540 Gap junction
    109576048 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109576048 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    109576048 (EGFR)
   04915 Estrogen signaling pathway
    109576048 (EGFR)
   04921 Oxytocin signaling pathway
    109576048 (EGFR)
   04926 Relaxin signaling pathway
    109576048 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    109576048 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109576048 (EGFR)
   05206 MicroRNAs in cancer
    109576048 (EGFR)
   05205 Proteoglycans in cancer
    109576048 (EGFR)
   05230 Central carbon metabolism in cancer
    109576048 (EGFR)
   05231 Choline metabolism in cancer
    109576048 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109576048 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109576048 (EGFR)
   05212 Pancreatic cancer
    109576048 (EGFR)
   05225 Hepatocellular carcinoma
    109576048 (EGFR)
   05226 Gastric cancer
    109576048 (EGFR)
   05214 Glioma
    109576048 (EGFR)
   05218 Melanoma
    109576048 (EGFR)
   05219 Bladder cancer
    109576048 (EGFR)
   05215 Prostate cancer
    109576048 (EGFR)
   05213 Endometrial cancer
    109576048 (EGFR)
   05224 Breast cancer
    109576048 (EGFR)
   05223 Non-small cell lung cancer
    109576048 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109576048 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    109576048 (EGFR)
   05171 Coronavirus disease - COVID-19
    109576048 (EGFR)
   05163 Human cytomegalovirus infection
    109576048 (EGFR)
   05165 Human papillomavirus infection
    109576048 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109576048 (EGFR)
   01522 Endocrine resistance
    109576048 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109576048 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109576048 (EGFR)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109576048 (EGFR)
Protein kinases [BR:biu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   109576048 (EGFR)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109576048 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   109576048 (EGFR)
  Exosomal proteins of bladder cancer cells
   109576048 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Borrelia_P83 Kinase-like Kdo
Other DBs
NCBI-GeneID: 109576048
NCBI-ProteinID: XP_019839912
UniProt: A0A6P5DSH4
LinkDB
Position
22
AA seq 1208 aa
MRLSGAGRAALLVLLAAHFQTSLALEEKXVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYMQSSYNLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNVLYENTHALA
VLSNYGANKTGLRELPLRNLQEILQGAVRFSNNPVLCNVETIQWRDIVNPDFLSNMTGDF
QNQQGNCPKCDPACLNRSCWGAGEENCQKLTKIICAQQCSGRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCRRFRDEATCKDTCPPLMLYDPTTYEMKVNPLGKYSFGATCVKKCPRNYV
VTDHGSCVRACSSDSQEVEEDGVRKCKKCDGPCGKVCNGIGIGEFKDTLSINATNIKHFR
NCTSISGDLHILPVAFRGDSFTRTAPLDPKELDILRTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNRNLCYADTIRWKKL
FGTSTQKTKILNNRSEKQCKAAGHICHPLCSSEGCWGPGPKYCMSCQNFSRGKECVGKCN
ILEGEPREFVENSECVQCHPECLPQAMNVTCTGRGPGNCVKCAHYIDGPHCVKTCPAGVA
GENGTLIWKFADANHVCLLCHPNCTYGCEGPGLEGCPQKGPKIPSIATGIVGGLLLVVVL
ALSVGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKVKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNVGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISTVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLVPQ
QGFFHSPTTSRTPLLSSLSTSSNTPTVTCVDRNGSYPLKEDSFLQRYSSDPTGALIEDSM
DDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLYPAPGRDPQYQNSLSNAVDNPEYLNTT
HPACINGVLDGPALWAQKGSHQFSLDNPDYQQAFFPKEAKSNGIFKGPAAENAEYLRAAP
AGSDFTGA
NT seq 3627 nt   +upstreamnt  +downstreamnt
atgcgactctccggggcgggccgcgcggcgctcctggtgctgctggcagcgcacttccag
acgagtctagcgctggaggagaagaragtttgccaagggacaagcaacaagctcacccag
ttgggcacttttgaagaccactttctgagcctacagaggatgttcaacaactgtgaggtg
gtccttgggaatttggaaattacctacatgcagagtagttacaacctttcttttctcaag
accatccaggaggttgccggctatgtactcattgccctcaacacagtggagaagattccg
ctggaaaacctgcagatcatccgaggaaatgtgctttatgaaaacacccatgccttagcc
gtcttatccaactatggagcaaacaaaaccggactgagggagctgcccttgagaaactta
caggaaattctgcaaggtgccgtgagattcagcaacaaccctgtcctctgcaacgtggag
accatccagtggcgggacatcgtcaaccctgattttctaagcaacatgacaggggacttt
cagaaccagcagggcaactgcccaaagtgtgatccagcctgtctcaacagaagctgctgg
ggtgccggggaggaraactgtcagaaattgaccaaaatcatctgtgcccagcagtgttcc
gggcgctgccgtggcaggtcccccagtgactgctgccacaaccagtgtgccgctggctgc
acagggccacgggagagcgactgcctggtctgccgcaggttccgtgatgaagccacctgc
aaggacacgtgtccgccactcatgctctatgaccctaccacctacgaaatgaaggtcaac
ccgctggggaagtacagctttggcgccacctgtgtcaagaagtgtccccgtaactacgtg
gtgacagaccacggctcctgcgtccgcgcctgcagttctgacagccaggaggtagaggaa
gacggtgtccgcaagtgtaaaaagtgtgacgggccttgtggcaaagtttgtaacggaata
ggaatcggtgagtttaaagacacactttccataaatgctacaaacattaaacacttcaga
aactgcacatccatcagtggagatcttcatatcctgccagtagcatttaggggtgactcc
ttcacacgtactgcacctctggacccgaaagaactggacattctaagaactgtaaaagaa
ataacagggtttttgctgattcaggcctggcccgaaaacaggactgacctccatgctttt
gagaacctggaaatcatacgtggcagaacgaagcagcatggccagttttctcttgcggtt
gtcggcctggatataacatctttgggattacgctccctcaaggagataagtgatggtgat
gtgataatttcaggaaatcgaaacttgtgctatgcagatacaatacgctggaaaaaactt
tttgggacctcaactcagaaaaccaaaattttaaacaacaggagtgaaaaacagtgcaag
gccgcaggccacatctgtcacccgctgtgctcatcagagggctgctggggaccgggaccc
aaatactgcatgtcctgccagaacttcagtcgtggcaaggagtgtgtgggaaagtgcaac
attctagagggagagcccagagaattcgtggagaactccgagtgtgtgcagtgccatcca
gaatgcctgccccaggccatgaacgtgacctgcactggacgcggaccaggcaactgtgta
aagtgcgcccactacattgatggccctcactgcgtcaagacctgccctgctggagtcgcg
ggagagaatggcaccctgatctggaagtttgcagatgccaaccacgtgtgtctcctgtgc
caccccaactgcacctatggctgtgaagggccaggtctcgaaggctgtccacaraaaggg
cccaagatcccgtccattgccacgggcatcgtgggcggcctgctgctggtggtggtgctg
gccctgagcgtcggcctcttcatgcgcaggcgccacatcgtgcgcaagcgcacactgcgc
cggctgctgcaggagcgtgagctcgtggagcctctgacgcccagcggagaagctcccaac
caagctctcttgaggatcctaaaggaaacagaattcaagaaggtcaaggtgctgggctcg
ggagcatttggcaccgtgtacaagggactctggatcccagaaggcgagaaggttaaaatt
cctgtagctatcaaggaattaagagaagccacatctccaaaagccaacaaggaaattctt
gatgaggcctacgtgatggccagtgtggacaacccccatgtgtgccgcctcctgggcatc
tgcctgacctccaccgtgcagctcatcacacagctcatgcccttcggctgcctgctggac
tacgtccgcgagcacaaggacaatgtcggctcccagtacctgctcaactggtgtgtgcag
atcgcaaagggcatgaattacctggaagaccggcgcttggtgcatagggacctggcagcc
aggaacgtgctggtgaagacgccgcagcacgtgaagatcacagacttcgggctggccaag
ctgctgggtgccgaggagaaggagtatcatgcagaaggaggcaaggtccctatcaaatgg
atggctttggaatcaattttacaccgaatttatacccatcagagtgatgtctggagctat
ggagtcactgtttgggagttgatgacctttggatccaagccttacgatggaatccctgcg
agtgagatctcgactgtcctggagaaaggagagcgcctcccacagccacccatctgcacc
atcgacgtctacatgatcatggtcaagtgctggatgatagatgcagacagtcgcccaaag
ttccgtgagttgatccttgaattctccaagatggcccgagacccccagcgctaccttgtc
atccagggggacgagagaatgcatttgccaagccctacggactccaacttctaccgcgcc
ctgatggatgaggaggacatggaggatgttgtggatgcygatgagtacctcgtcccccag
cagggcttcttccacagccccaccacctcccggacacccctcctcagctcgctgagcacc
tccagcaacactcccactgtgacttgcgttgatagaaatgggagctaccctctcaaggaa
gacagcttcctgcagcgctacagctcagaccccactggtgccctcatcgaggacagcatg
gacgacgctttcctcccagtacccgaatatgtaaaccaatctgttcccaaaagacccgca
ggctctgtccagaaccctgtctatcacaatcagcctctatatccagctcctggcagagac
cctcagtaccaaaattcwctcagcaacgccgtggacaaccctgagtatctcaacaccacc
catcctgcctgtatcaatggtgtgctcgacggccctgccctctgggctcagaagggcagt
caccaatttagcctagacaaccctgactaccagcaggccttctttcccaaggaagccaag
tcgaatggcatctttaaggggcctgcagctgaaaatgcagaatacctgcgggcagcacca
gcaggcagtgactttactggggcctga

DBGET integrated database retrieval system