KEGG   Bos indicus (zebu cattle): 109576112
Entry
109576112         CDS       T04792                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04015  Rap1 signaling pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04510  Focal adhesion
biu04520  Adherens junction
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04670  Leukocyte transendothelial migration
biu04916  Melanogenesis
biu04919  Thyroid hormone signaling pathway
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05100  Bacterial invasion of epithelial cells
biu05132  Salmonella infection
biu05160  Hepatitis C
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05210  Colorectal cancer
biu05213  Endometrial cancer
biu05215  Prostate cancer
biu05216  Thyroid cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109576112 (CTNNB1)
   04310 Wnt signaling pathway
    109576112 (CTNNB1)
   04390 Hippo signaling pathway
    109576112 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109576112 (CTNNB1)
   04520 Adherens junction
    109576112 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    109576112 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109576112 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109576112 (CTNNB1)
   04916 Melanogenesis
    109576112 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109576112 (CTNNB1)
   05205 Proteoglycans in cancer
    109576112 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109576112 (CTNNB1)
   05225 Hepatocellular carcinoma
    109576112 (CTNNB1)
   05226 Gastric cancer
    109576112 (CTNNB1)
   05216 Thyroid cancer
    109576112 (CTNNB1)
   05217 Basal cell carcinoma
    109576112 (CTNNB1)
   05215 Prostate cancer
    109576112 (CTNNB1)
   05213 Endometrial cancer
    109576112 (CTNNB1)
   05224 Breast cancer
    109576112 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109576112 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    109576112 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109576112 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109576112 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109576112 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109576112 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    109576112 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    109576112 (CTNNB1)
   05163 Human cytomegalovirus infection
    109576112 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109576112 (CTNNB1)
   05165 Human papillomavirus infection
    109576112 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 109576112
NCBI-ProteinID: XP_019840048
UniProt: A0A6P5DQB9
LinkDB
Position
22
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctacccaagctgatttgatggagctggacatggccatggagccagacagaaaagca
gccgtcagtcactggcagcagcagtcttacctggactctggaatccattctggtgccacc
accacagctccttctctgagcggtaaaggcaatcctgaggaagaggatgtggataccacc
caagtcctgtatgagtgggaacaggggttttctcagtccttcactcaagaacaagtagct
gatattgatggacagtatgcaatgactcgagctcagagggtgagagctgctatgttccct
gagacgctagatgagggcatgcagatcccatctacacagtttgatgccgctcatcccact
aacgtccagcgtctggctgaaccatcacagatgctgaaacatgcagttgtaaacttaatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaattgacaaaactgctg
aatgatgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttcgagacacgccatcatgcgttctcctcagatggtgtctgctatcgtacgc
accatgcagaacacaaatgacgtggagacagctcgctgcactgctgggaccttgcacaat
ctttcccaccatcgtgagggcttgctggccatctttaaatctgggggcattcctgccctg
gtgaagatgctyggttcaccagtggattctgtattgttttatgccattacaactctccac
aaccttttattgcatcaggaaggagctaaaatggccgtgcgtttagctggcgggctgcag
aaaatggttgccttgctcaacaaaacgaatgttaaattcttggctattacaacagattgt
cttcagattctagcttayggcaatcaagaaagcaagctcatcatcctggctagtggtgga
cctcaagctctagtgaatataatgaggacctacacttatgagaagctactgtggaccaca
agcagagtgctgaaggtgctgtctgtctgctccagtaacaagccggctattgtagaagct
ggtggaatgcaagctttaggacttcacctgacagatccaagtcagcgccttgttcagaac
tgcctttggactctaaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
cttcttgggactcttgttcagcttctgggctcagatgatatcaatgtggtcacctgtgca
gctggaattctttctaatctcacttgcaataattataagaacaagatgatggtgtgccaa
gtgggtggcatagaggcccttgtgcgcacggtcctccgtgctggggacagggaagacatc
actgagcctgccatctgtgcccttcgtcatctgaccagccggcaccaggaggctgagatg
gcccagaacgctgttcgccttcactacgggctacctgtggtggttaaactcctacatcca
ccatcccactggcctctgatcaaggctactgttggattgattcgaaatcttgccctttgt
ccagcaaatcatgcacctttgcgtgagcagggtgccattccacgactagttcagttgctg
gttcgtgcacatcaggatacccagcgtcgtacatctatgggtggaacacagcagcagttt
gtggagggagtccgcatggaagaaatagttgaaggttgtactggagcccttcacatccta
gctcgggatgttcacaaccgaatcgttatcagaggactaaataccattccattgtttgtg
cagctgctttattctcctattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaagctgcagaagctattgaagccgagggagccacagctcctctg
acagaattacttcattctaggaatgaaggtgtggcaacatatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaggattataagaaacggctttcggttgagctgaccagt
tctctcttcagaacggagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaacctcttggatatcgccaggatgatcccagctatcgttcttttcac
tctggtgggtacggccaggacgccttggggatggaccccatgatggaacatgagatgggc
ggccaccaccctggtgctgactatccagttgacgggctgccagatctggggcatgcccag
gacctcatggatgggctgcccccgggcgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system