KEGG   Bos indicus (zebu cattle): 109576148
Entry
109576148         CDS       T04792                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04060  Cytokine-cytokine receptor interaction
biu04068  FoxO signaling pathway
biu04144  Endocytosis
biu04218  Cellular senescence
biu04350  TGF-beta signaling pathway
biu04380  Osteoclast differentiation
biu04390  Hippo signaling pathway
biu04520  Adherens junction
biu04659  Th17 cell differentiation
biu04926  Relaxin signaling pathway
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05142  Chagas disease
biu05161  Hepatitis B
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05220  Chronic myeloid leukemia
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109576148 (TGFBR2)
   04350 TGF-beta signaling pathway
    109576148 (TGFBR2)
   04390 Hippo signaling pathway
    109576148 (TGFBR2)
   04068 FoxO signaling pathway
    109576148 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109576148 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109576148 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    109576148 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109576148 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109576148 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    109576148 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109576148 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109576148 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    109576148 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109576148 (TGFBR2)
   05212 Pancreatic cancer
    109576148 (TGFBR2)
   05225 Hepatocellular carcinoma
    109576148 (TGFBR2)
   05226 Gastric cancer
    109576148 (TGFBR2)
   05220 Chronic myeloid leukemia
    109576148 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109576148 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109576148 (TGFBR2)
   05161 Hepatitis B
    109576148 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109576148 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109576148 (TGFBR2)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     109576148 (TGFBR2)
Protein kinases [BR:biu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   109576148 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 109576148
NCBI-ProteinID: XP_019840141
LinkDB
Position
22
AA seq 567 aa
MGRGLLGGLWPLHVVLWTRIASTIPPHVPKSVNSDMMVTDHNGAIKLSQLCKFCDVRSST
CDNQKSCWSNCSITAICEKPEEVCVAVWRKNDENITLETVCHDPKIAYHGFVLDDAASSK
CIMKERKGSGETFFMCSCSSEECNDHIIFSEEYTSSNPDLLLVIFQVTGVSLLPPLGIAI
AVIITFYCYRIHRQQKLSPAWDSGKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTE
LXPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRRLGGSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKGDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSSWLNHQGIQTVCETLAECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSSSEEKIPEDGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggccgggggctgctcgggggcctgtggccgctgcacgtcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttcccaagtcggttaacagcgatatgatggtcactgac
cacaacggygccatcaagctgtcrcagctgtgtaagttctgcgacgtgcggtcgtccacc
tgtgacaaccagaagtcctgctggagcaactgcagcatcacggccatctgcgagaagccg
gaggaggtctgcgtggctgtctggaggaagaatgatgagaacatcacgctggagacagtc
tgccacgaccccaagattgcctaccatggatttgtcctggacgatgctgcttcttcaaag
tgtatcatgaaggaaagaaaggggtccggagagactttcttcatgtgctcctgcagctcc
gaagagtgcaatgaccacatyatcttctccgaagagtacaccagcagtaaccccgacttg
ctgctggttatcttccaagtgacaggcgtcagcctcctgccaccgctgggcatcgccatc
gcagtcatcatcactttctactgctaccgcatccaccggcagcagaagctgagcccagcc
tgggactcgggcaagccgcgcaagctgatggagttcagtgagcacctggccatcatcctg
gaggacgaccgctccgacatcagctccacctgygccaacaacatcaaccacaacacggag
ctgcygcccatcgagctggacaccctggtgggcaaggggcgcttcgccgaggtctacaag
gccaagctgaagcagaacacgtctgagcagttcgagaccgtggccgtcaagatcttcccc
tacgaggagtatgcctcctggaagacggagaaggacatcttctcggacatcaacctcaag
cacgagaacatcctgcagttcctgacggccgaggagcgcaagacggagctgggcaagcag
tactggctcatcactgccttccacgccaagggcaacctgcaggagtacctgacgcgccac
gtcatcagctgggaggacctgcgccggctgggcggctcgctggcccgcggcatcgcgcac
ctgcacagcgaccacaccctgtgcggccggcccaagatgcccatcgtgcacagggacctc
aagagctccaacatcctggtcaagggcgacctcacctgctgcctctgcgacttcgggctc
tcactgcggctggaccccaccctgtcagtggatgacctggccaacagtgggcaggtggga
acggcgagatacatggctccagaggtcctcgagtccaggatgaatctggagaacgtggag
tccttcaagcagacggatgtctactccatggccctggtgctctgggagatgacgtctcgc
tgcaacgcagtgggagaagtgaaggactatgagcctccgttcgggtctaaggtgcgggag
catccctgtgtggaaagcatgaaggacaacgtgctgagagatcgaggccgaccagagatt
cccagctcctggctcaaccaccagggcatccagacggtgtgcgagacrctggccgaatgc
tgggaccatgaccccgaggcccggctcacggcgcagtgcgtggccgagcgcttcagygag
ctggagcacctggacaggctctccgggaggagcagctcggaggagaagatccccgaagat
ggctccctcaacactaccaaatag

DBGET integrated database retrieval system