KEGG   Bos indicus (zebu cattle): 109576171
Entry
109576171         CDS       T04792                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04071  Sphingolipid signaling pathway
biu04072  Phospholipase D signaling pathway
biu04144  Endocytosis
biu04150  mTOR signaling pathway
biu04270  Vascular smooth muscle contraction
biu04310  Wnt signaling pathway
biu04350  TGF-beta signaling pathway
biu04360  Axon guidance
biu04510  Focal adhesion
biu04520  Adherens junction
biu04530  Tight junction
biu04611  Platelet activation
biu04621  NOD-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04660  T cell receptor signaling pathway
biu04670  Leukocyte transendothelial migration
biu04722  Neurotrophin signaling pathway
biu04810  Regulation of actin cytoskeleton
biu04921  Oxytocin signaling pathway
biu04928  Parathyroid hormone synthesis, secretion and action
biu04972  Pancreatic secretion
biu05100  Bacterial invasion of epithelial cells
biu05132  Salmonella infection
biu05133  Pertussis
biu05135  Yersinia infection
biu05152  Tuberculosis
biu05163  Human cytomegalovirus infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109576171 (RHOA)
   04015 Rap1 signaling pathway
    109576171 (RHOA)
   04310 Wnt signaling pathway
    109576171 (RHOA)
   04350 TGF-beta signaling pathway
    109576171 (RHOA)
   04072 Phospholipase D signaling pathway
    109576171 (RHOA)
   04071 Sphingolipid signaling pathway
    109576171 (RHOA)
   04024 cAMP signaling pathway
    109576171 (RHOA)
   04022 cGMP-PKG signaling pathway
    109576171 (RHOA)
   04150 mTOR signaling pathway
    109576171 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109576171 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109576171 (RHOA)
   04520 Adherens junction
    109576171 (RHOA)
   04530 Tight junction
    109576171 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109576171 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109576171 (RHOA)
   04621 NOD-like receptor signaling pathway
    109576171 (RHOA)
   04625 C-type lectin receptor signaling pathway
    109576171 (RHOA)
   04660 T cell receptor signaling pathway
    109576171 (RHOA)
   04670 Leukocyte transendothelial migration
    109576171 (RHOA)
   04062 Chemokine signaling pathway
    109576171 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109576171 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    109576171 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109576171 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    109576171 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109576171 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    109576171 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109576171 (RHOA)
   05206 MicroRNAs in cancer
    109576171 (RHOA)
   05205 Proteoglycans in cancer
    109576171 (RHOA)
   05203 Viral carcinogenesis
    109576171 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109576171 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109576171 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109576171 (RHOA)
   05135 Yersinia infection
    109576171 (RHOA)
   05133 Pertussis
    109576171 (RHOA)
   05152 Tuberculosis
    109576171 (RHOA)
   05100 Bacterial invasion of epithelial cells
    109576171 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    109576171 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109576171 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109576171 (RHOA)
   04031 GTP-binding proteins [BR:biu04031]
    109576171 (RHOA)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    109576171 (RHOA)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109576171 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   109576171 (RHOA)
  Exosomal proteins of colorectal cancer cells
   109576171 (RHOA)
  Exosomal proteins of bladder cancer cells
   109576171 (RHOA)
GTP-binding proteins [BR:biu04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    109576171 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 109576171
NCBI-ProteinID: XP_019840189
UniProt: A0A6P5DQR1
LinkDB
Position
22
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggagatggagcctgtggcaagacttgc
ttgctcattgtctttagcaaggaccagttcccagaggtgtatgtccctacggtgtttgag
aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttatgggacaca
gctgggcaggaagattatgatcgcttgaggcctctctcctacccggataccgacgttata
ctgatgtgtttctccattgatagccctgatagtttagaaaacataccagaaaaatggact
ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat
cttcgaaacgacgagcacacaaggcgggagctggccaagatgaagcaggagccagtaaaa
cccgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system