KEGG   Bos indicus (zebu cattle): 109576238Help
Entry
109576238         CDS       T04792                                 

Gene name
AMT
Definition
(RefSeq) aminomethyltransferase, mitochondrial
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00260  Glycine, serine and threonine metabolism
biu00630  Glyoxylate and dicarboxylate metabolism
biu00670  One carbon pool by folate
biu01100  Metabolic pathways
biu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    109576238 (AMT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    109576238 (AMT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    109576238 (AMT)
Enzymes [BR:biu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     109576238 (AMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_T GCV_T_C sCache_3_2
Motif
Other DBs
NCBI-GeneID: 109576238
NCBI-ProteinID: XP_019840341
LinkDB All DBs
Position
22
AA seq 403 aa AA seqDB search
MQQARSMVSRLSSRLQALASAPCRSLSCAQDVLHRTPLYDFHLAHGGKMVAFAGWSLPVQ
YRDSHVNSHLHTRQHCSLFDVSHMLQTKIFGCDRVKLMESLVVGDIAELKPNQGTLSLFT
NEAGGILDDLIVTSASEGHLYVVSNAGCREKDLTLMQDKVRELQNKGSDVALEVMDNALL
ALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPAAEA
VHLAAALLKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAM
DFPGASVIVPQLKSKAQRRRVGLMCDGAPVRAQSPILSPEGTVIGAVTSGCPSPCLKKNV
AMGYVPYEYSRPGTPLLVEVRRKQQPAVVSKMPFVSTNYYILK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggctaggagcatggtatcccgtctgagctcgcgtctgcaagctctggcctcg
gccccatgccgttcgctcagttgtgcgcaggacgtgctccacaggacaccgctctatgac
ttccacctggcccacggcgggaagatggtggcgttcgcgggctggagcctgcccgtgcag
taccgggatagccacgtgaattcacacctgcatacacggcagcactgctcgctctttgac
gtgtcccacatgctgcagaccaagatatttggctgtgaccgggtgaagctgatggagagt
ctagtggttggagatattgcagagctgaagccaaaccagggaacactgtcgctgtttacc
aacgaggctggaggcatcttagatgacttgattgtgaccagcgcctccgagggacacctg
tatgtggtgtccaatgctggctgcagggagaaggacctgaccctcatgcaggacaaggtt
agggagcttcagaacaagggcagtgatgtggccctggaggtgatggataatgctctgcta
gccctgcaaggtcccactgcagcccaggtgctacaggctggcgtggctgatgatctgcgg
aaactgcccttcatgaccagcgctgtgatggaggtgtttggtgtgtctggctgccgtgtg
acccgctgtggctacacaggagaggacggtgtggagatctcagtgccggcagcggaagcc
gtccacctggcagcagctctgttgaaaaaccctgaggtgaagctggcaggactggcagcc
cgggacagcctgcgcctggaggcaggcctctgcttgtatgggaacgacattgatgagcac
accacaccggtggaaggcagcctgagctggacactcgggaagcgccgccgagctgctatg
gacttcccaggagcctcggtcattgttccccagctgaagagcaaggcacagcggaggcgt
gtggggttaatgtgtgacggggctcccgtacgggcacagagtcccatcctgagtccagag
ggtactgtgatcggtgctgtgaccagtggctgcccctcaccctgcctgaaaaagaatgtg
gcaatgggttatgtgccctatgagtacagtcggccaggcaccccactgctggtagaggtg
cggcggaagcagcagccggccgtggtcagcaagatgccctttgtgtccacaaactactac
atccttaagtga

DBGET integrated database retrieval system