KEGG   Bos indicus (zebu cattle): 109576291
Entry
109576291         CDS       T04792                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04014  Ras signaling pathway
biu04390  Hippo signaling pathway
biu04392  Hippo signaling pathway - multiple species
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05219  Bladder cancer
biu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109576291 (RASSF1)
   04390 Hippo signaling pathway
    109576291 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    109576291 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109576291 (RASSF1)
   05206 MicroRNAs in cancer
    109576291 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    109576291 (RASSF1)
   05223 Non-small cell lung cancer
    109576291 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 109576291
NCBI-ProteinID: XP_019840427
LinkDB
Position
22
AA seq 340 aa
MSAEPELIELRELAPERCAAPGRTRLERANALRIAPGTARNAARQQVPGRXXXFQPAGPA
THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVSLDCCGPRDLGWEPALERDTNVD
EPVEWETPDLSQAEIEQKIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSK
KPPSLQDARRGPGRGTAVKRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPR
KFALFERAERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPE
LHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtccgctgagcctgagctcattgaactgcgggaactggcacccgaacggtgcgccgcc
ccggggcgcacccggctcgagcgtgccaatgcattgcgcatcgcgccgggcacagcgcgc
aacgccgcaaggcagcaggtcccgggccggnnnnnnngcttccagcccgcggggcccgct
acgcacacgtggtgtgacctgtgtggcgacttcatctggggcgtcgtgcgcaagggtctg
cagtgcgcgcattgcaagttcacctgccactaccgctgccgcgcgctcgtctccctagac
tgctgcgggccccgggacctgggctgggaaccggcgctggagcgggacacgaatgtggac
gagcccgtggagtgggagacacctgacctttctcaagctgagatcgagcagaagatcaag
gagtacaatggccagatcaacagcaacttgttcatgagcctgaacaaggatggctcctac
acaggcttcatcaaggttcaactgaagctggtgcgccctgtctcagttccctccagcaag
aagccaccctccctgcaggatgcccggcgaggcccagggcggggcacagctgtgaaacgc
cgcacctccttctacctgcccaaggatgctgtcaagcacctgcatgtgttgtcacgcacg
cgggcacgtgaggtcatcgaggccctgttgcgtaaattcctggtggtggatgaccctcgc
aagtttgcactctttgagcgggctgagcgccatggccaagtgtacctccggaagctgtcc
gatgatgagcagcccctacgcctccggctccttgcagggcccagtgagaaggccctaagc
tttgtgctgaaggagaatgactctggggaggtgaattgggacgctttcagcatgcctgag
ctacacaactttctgcgcatcctgcagcgggaggaagaggaacacctccgccagatcctg
cagaagtactcctattgtcgccagaagatccaggaagccctgcacgcctgccccctgggg
tga

DBGET integrated database retrieval system