KEGG   Bos indicus (zebu cattle): 109576359
Entry
109576359         CDS       T04792                                 

Gene name
CISH
Definition
(RefSeq) cytokine-inducible SH2-containing protein
  KO
K04701  cytokine inducible SH2-containing protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04630  JAK-STAT signaling pathway
biu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109576359 (CISH)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109576359 (CISH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109576359 (CISH)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:biu04990]
    109576359 (CISH)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     109576359 (CISH)
Domain-containing proteins not elsewhere classified [BR:biu04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   109576359 (CISH)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 109576359
NCBI-ProteinID: XP_019840516
UniProt: A0A6P5DQM4
LinkDB
Position
22
AA seq 254 aa
MVLCVQGLCPLLAVEQIGQRPLWAQSLELPQQVMQPLSAGAFLXEAVEESPAQPEREPKV
VDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDLAT
TPALPTPKEDAPGDPALPATAVHLKLVQPFVRRSSTRSLQHLCRLVINRLVVDVDCLPLP
RRMADYLRQYPFQL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggtcctctgcgttcagggactttgtcctttgctggccgtggagcagattgggcagcgg
cccctgtgggcccagtccctggagctgccccagcaagttatgcagcctttgtctgctggc
gccttcctggasgaggcagtagaggagtccccagcccagccagagagggagcccaaggtg
gtggacccygaggaggacctgctgtgcatagccaagaccttctcctaccttcgggaatct
ggctggtactggggttccattacggccagtgaggcccggcaacaccttcagaagatgcca
gagggcaccttcctggtacgtgacagcacccaccccagctacctgttcacactgtccgtc
aagaccacccgcgggcccaccaacgtgcgcattgagtacgccgactccagcttccgcctg
gactccaactgcctgtccaggcctcgcatcctggccttcccagatgtggtgagcctggtc
cagcactacgtggcctcctgtgctgcagacacccggagtgacagtcccgaccttgccacc
accccggccctgcccaccccgaaggaagatgcgcccggtgacccagccctgcccgccacg
gccgttcacctgaaactggtacagccctttgtgcgcaggagcagcacccggagcctgcag
cacctgtgccgcctggtcatcaaccgcctggtggtcgacgtggactgcctgccgcttccc
cggcgcatggctgactacctccgacaataccccttccagctctga

DBGET integrated database retrieval system