KEGG   Bos indicus (zebu cattle): 109576388Help
Entry
109576388         CDS       T04792                                 

Gene name
PRKCD
Definition
(RefSeq) protein kinase C delta type isoform X1
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04062  Chemokine signaling pathway
biu04140  Autophagy - animal
biu04270  Vascular smooth muscle contraction
biu04621  NOD-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04722  Neurotrophin signaling pathway
biu04750  Inflammatory mediator regulation of TRP channels
biu04912  GnRH signaling pathway
biu04915  Estrogen signaling pathway
biu04930  Type II diabetes mellitus
biu04931  Insulin resistance
biu04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109576388 (PRKCD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109576388 (PRKCD)
   04625 C-type lectin receptor signaling pathway
    109576388 (PRKCD)
   04666 Fc gamma R-mediated phagocytosis
    109576388 (PRKCD)
   04062 Chemokine signaling pathway
    109576388 (PRKCD)
  09152 Endocrine system
   04912 GnRH signaling pathway
    109576388 (PRKCD)
   04915 Estrogen signaling pathway
    109576388 (PRKCD)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109576388 (PRKCD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109576388 (PRKCD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109576388 (PRKCD)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109576388 (PRKCD)
   04931 Insulin resistance
    109576388 (PRKCD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109576388 (PRKCD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109576388 (PRKCD)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     109576388 (PRKCD)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   109576388 (PRKCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 Pkinase_C C1_2 Kinase-like zf-RING-like Zf_RING Haspin_kinase PHD Pkinase_fungal zf-RING_9 DZR DUF2318 FYVE_2
Motif
Other DBs
NCBI-GeneID: 109576388
NCBI-ProteinID: XP_019840558
LinkDB All DBs
Position
22
AA seq 687 aa AA seqDB search
MAPFLRISFNSYELGSLKAADEASQPFCAVKMKEALSTDRGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEEPMSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDVDCKQSMRGEDEAKFPTMNRRGAIKQAKIHYIRHHEFIATFFGQPTFCSVCREFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVYNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCQMKVANLCGINQKLLAEALNQVSQAAPP
NPHPLLQRSVKKETETQDTVGIYQNFEKKPGVSGDDLAGKETGTYGKIWESSTKCNIDNF
TFIKVLGKGSFGKVLLAELKGKKEFFAIKALKKDVVLIDDDVECTMVEKRVLALAGDHPF
LTHLFCTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELSRATFYAAEIVCGLQFLHQKGI
IYRDLKLDNVLLDHSGHIKIADFGMCKENMSGDRQASTFCGTPDYIAPEILQGLKYSFSV
DWWSFGVLLYEMLIGQSPFHGDDEDELFESIRLDSPYYPRWITKESKDILEKLLERDVSK
RLGVTGNIKIHPFFKTINWVLLEKRAVEPPFKPKVKSPGDFSNFDQEFLNEKPRLSYSDK
NLIESMDQTAFAGFSFVNPKFERLLEN
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgttcctgcgcatctccttcaactcctacgagctgggctccctgaaggccgcg
gacgaggcaagccagcccttctgtgctgtgaagatgaaggaggctctcagcacagatcgc
gggaagacgctggtgcagaagaagcccaccatgtaccctgagtggaagtccacattcgat
gctcacatctacgagggccgcgttatccagatagtgctgatgcgagccgccgaagagcca
atgtcggaggtgacggtgggtgtgtcagtgctagccgagcgctgcaagaagaacaatggc
aaggccgagttctggctggacttgcaaccccaggccaaggtgctgatgtcggtgcagtat
ttcctggaagacgtagattgcaagcagtctatgcggggtgaagacgaggccaagttccca
acaatgaaccgccgtggagctatcaaacaggccaaaattcactacatcaggcaccacgag
ttcatcgccaccttctttgggcagcccacattctgctccgtgtgcagagagtttgtttgg
ggtctcaacaagcaaggctacaagtgcaggcaatgtaatgctgccatccacaagaaatgc
atcgacaagatcatcggccggtgtacaggcactgcagccaacagtcgggacaccatattc
cagaaagaacgtttcaacatcgacatgccgcaccggttcaaggtttataactacatgagc
cccaccttctgtgaccactgtggcagcctgctctgggggctggtgaagcagggattaaag
tgtgaagactgtggcatgaacgtgcatcacaagtgccagatgaaagtggccaacctctgt
ggcatcaaccagaagctcttggccgaggccttgaaccaagttagccaggccgctcccccc
aacccccaccccctcctccagagatctgtaaagaaggaaacagagacccaagacactgtt
gggatctaccagaattttgagaagaagccaggagtctctggagatgatctcgcaggtaaa
gaaactgggacctacggcaagatctgggagagcagcaccaagtgcaacattgacaacttc
accttcatcaaggtcctgggcaaaggcagcttcgggaaggtgctgctcgcagagctgaag
ggcaaaaaggaattcttcgccatcaaggctctcaagaaagacgtggtcttgatcgatgac
gacgtggagtgcaccatggtggagaagcgggtgctggccctcgccggggatcatccgttt
ctcacccacctcttctgcaccttccagaccaaggaccacctgttctttgtgatggagttc
ctcaatgggggcgacctgatgtaccacatccaggacaaaggccgcttcgagctctcccgt
gccacgttttacgcagctgagatagtctgtggactacagtttctgcaccagaaagggatc
atttacagggacctcaagctggacaacgtgttgctggaccacagtggccacatcaagatt
gccgacttcggcatgtgcaaggagaacatgtccggggacagacaggccagcaccttctgc
ggcacccctgactacatcgcccccgagatcctgcagggcctgaaatactcgttctccgtg
gactggtggtccttcggagtccttctctatgagatgctcattggtcagtcccccttccat
ggtgatgatgaggacgaactcttcgagtccatccgtttagactcaccatactatcctcgc
tggatcaccaaggagtccaaggacatcctggagaagctgcttgaacgggatgtaagcaag
aggctgggagtgacagggaacatcaaaatccaccccttcttcaagaccatcaactgggtt
ctgctggagaaacgtgcagtggagccacccttcaagcccaaagtgaagtcgcctggagac
ttcagcaacttcgaccaggagttcctgaatgagaagccgcgcctctcctacagcgacaag
aacctcatcgagtccatggaccaaacagcatttgctggcttctccttcgtgaaccccaaa
tttgagaggctcctggaaaactga

DBGET integrated database retrieval system