KEGG   Bos indicus (zebu cattle): 109576576
Entry
109576576         CDS       T04792                                 

Gene name
VEGFA
Definition
(RefSeq) LOW QUALITY PROTEIN: vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04066  HIF-1 signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04370  VEGF signaling pathway
biu04510  Focal adhesion
biu04926  Relaxin signaling pathway
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05219  Bladder cancer
biu05323  Rheumatoid arthritis
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109576576 (VEGFA)
   04014 Ras signaling pathway
    109576576 (VEGFA)
   04015 Rap1 signaling pathway
    109576576 (VEGFA)
   04370 VEGF signaling pathway
    109576576 (VEGFA)
   04066 HIF-1 signaling pathway
    109576576 (VEGFA)
   04020 Calcium signaling pathway
    109576576 (VEGFA)
   04151 PI3K-Akt signaling pathway
    109576576 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109576576 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    109576576 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109576576 (VEGFA)
   05206 MicroRNAs in cancer
    109576576 (VEGFA)
   05205 Proteoglycans in cancer
    109576576 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109576576 (VEGFA)
   05211 Renal cell carcinoma
    109576576 (VEGFA)
   05219 Bladder cancer
    109576576 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109576576 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109576576 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109576576 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    109576576 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109576576 (VEGFA)
   05165 Human papillomavirus infection
    109576576 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109576576 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109576576 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109576576 (VEGFA)
Cytokines and growth factors [BR:biu04052]
 Growth factors
  Growth factors (RTK binding)
   109576576 (VEGFA)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109576576 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 109576576
NCBI-ProteinID: XP_019840759
UniProt: A0A6P5DSA3
LinkDB
Position
23
AA seq 623 aa
MNDGGGAQRLGAAGLRRGRGVGGRVEPAAAALGRETHRRGGRTGGVTGQGSPHWNLIFIY
PGFTLLLFSETFFFXTVFFPVLIYFCLPFPTKSGRPSGEIALLLPPKITSDSGNKQRKKR
VARAPKRSEGRETGQRARADERHERDRGKVSDLFLGVTARAQREPSPSGSRVGPAALTDR
QTDTAPCPSAHLLPGXXXXXXXXXXXGQEPEPAPGGGVEGVGARDVALKLFVQLLGCSRS
GGAVVRAGAAEPSGTGRSARSGREEPQSEEGEEEEEKEEEKGPRWRLGSRKPGSWTGEAA
VXTDSAPAARGAEGIGGMLAEGNRGAMEMAPLTPNIWSFIIFPDFRIGAARRGGALCCRE
PLEVPCSVRKPGRSQRLQAGRGSRREQGRVGWACTPXPLPLPILRSLLCPQWSQAAPMAE
GGQKPHEVVKFMDVYQRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCNDESL
ECVPTEEFNITMQVGIGRELGWGRGWALRLWPQVFPSPFLAALKGRSYYILPSIVTRIKP
KKDKARQEKKSVRGKGKGQKRKRKKSRYKSWSAPCGPCSERRKHLFVQDPQTCKCSCKNT
DSRCKARQLELNERTCRCDKPRR
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgaatgatggagggggagcgcagaggcttggggcagccgggctgcgacgaggccgcggc
gttggggggcgagtggagccggcggcagcggcgctcggtcgggagacgcatcgaagaggc
ggacggaccggcggggtcaccggccaggggtctccgcactggaatttgatattcatttat
ccagggtttaccctcctccttttttctgaaacattttttttttwaaccgtattctttccc
gttttaatttatttttgcctcccattccccactaaatcgggccgaccgtctggggagatt
gctcttttactccccccgaaaatcacttcggattctggaaacaagcagagaaaaaagagg
gtagcaagagctccaaagagaagtgaaggaagagagaccggtcagagagcgcgcgctgac
gagcgacacgagagggacaggggcaaagtgagtgacctgtttttgggggtgaccgccaga
gcgcagcgtgagccctccccctcaggatcccgcgtcggaccagcagcgctgacggacaga
cagacagacaccgccccctgccccagcgcccacctcctccccggnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnngcgggcaggagccggagcccgcgcccggaggcggggtggagggg
gtcggggctcgcgacgttgccctgaaacttttcgtccaacttctgggctgttctcgttcc
ggaggagccgtggtccgtgccggggctgccgagccgagtggcaccgggagaagtgctcgc
tcgggccgggaggagccgcagtcggaggagggggaggaggaagaagagaaggaagaggag
aaggggccgcggtggcgactcggctctcggaagccgggctcatggacgggtgaggcagct
gtgntgacagacagtgctccagccgcgcgaggagcggagggcataggaggaatgttagca
gagggtaacaggggtgccatggagatggcccccctcacccccaatatctggtcattcatt
atcttccctgacttcagaattggagcagctcggagagggggtgctttgtgctgtagggag
cccctggaggtgccctgctcggttcggaagcccgggagaagccagaggctgcaggctggg
aggggttccaggagggagcaggggcgggttggctgggcctgcacacccttscccctgccg
ctgcccattcttcgctctttgctttgtcctcagtggtcccaggctgcacccatggcagaa
ggagggcagaaaccccacgaagtggtgaagttcatggatgtctaccagcgcagcttctgc
cgtcccatcgagaccctggtggacatcttccaggagtacccagatgagattgagttcatt
ttcaagccgtcctgtgtgcccctgatgcggtgcgggggctgctgtaatgacgaaagtctg
gagtgtgtgcccactgaggagttcaacatcaccatgcaggtgggcatcggcagggagctg
gggtggggccgggggtgggccctcaggctttggccacaggtgttccccagccctttcctg
gcagctcttaaagggaggagctattacatactgcctagcattgttacaaggattaaacca
aagaaagataaagcaaggcaagaaaaaaaatcagttcgaggaaagggcaaagggcaaaaa
agaaagcgcaagaaatcccggtataaatcctggagcgctccctgtgggccttgctcagag
cggagaaagcatttgtttgtacaagatccgcagacgtgtaaatgttcctgcaaaaacaca
gactcgcgttgcaaggcgaggcagcttgagttaaacgaacgtacttgcagatgtgacaag
ccgaggcggtga

DBGET integrated database retrieval system