KEGG   Bos indicus (zebu cattle): 109576792
Entry
109576792         CDS       T04792                                 

Definition
(RefSeq) placental prolactin-related protein 4
  KO
K05439  prolactin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04080  Neuroactive ligand-receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109576792
   04151 PI3K-Akt signaling pathway
    109576792
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109576792
   04060 Cytokine-cytokine receptor interaction
    109576792
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109576792
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109576792
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109576792
SSDB
Motif
Pfam: Hormone_1 DUF1968
Other DBs
NCBI-GeneID: 109576792
NCBI-ProteinID: XP_019840974
UniProt: A0A6P5DSX0
LinkDB
Position
23
AA seq 239 aa
MAPAPXFRGHQWTYNLVRGSCLLLLLVMSNLLLCQGILCPSLCPDGDDVCRASLIDLFVH
ASVLSTGMYNHSVKMFTDFDEQYAQGKEYFINVSDKCHTNSLHLPEDMQHIRRMNSKGLI
MWILMLLYSWQRPLYQLVTDLRSMKEVSNTILSSARENVKKLKELQALIERPFSQVIFTA
RRKMYJARIYWFGLRSLLSSNEDRRHSAFYSLFFCLRRDTRKLDIYTKFVACRLIYKKC
NT seq 720 nt   +upstreamnt  +downstreamnt
atggctccagctcccarcttccgtggacaccagtggacttacaaccttgtccgagggtcc
tgcctgctcctgctgctggtcatgtcaaatctgctcttgtgccaaggcatcttatgcccg
tccctctgtcctgacggggatgacgtctgccgggcctcccttatagacctgtttgtccat
gcctccgttctgtccaccggcatgtataaccactccgtgaaaatgttcactgattttgat
gaacagtatgcccagggcaaagagtactttatcaatgtctccgacaagtgccacaccaat
tccctccatctccctgaagacatgcagcacatccgacggatgaacagtaaaggccttatt
atgtggatactcatgttactatactcctggcaaagacctctgtatcagctagtcacggac
ctgcggagtatgaaagaagtctcaaatactatcctatccagcgctagagaaaatgtgaaa
aaactaaaagaacttcaagcactcatagagaggccgttcagccaggttatttttacagcc
aggaggaagatgtacmtcgctcgcatttactggtttggactccgatccctactgtcgagc
aatgaagataggcgtcattctgcattttatagcctgttcttctgcctgcgcagagatact
cgtaaacttgacatttacaccaagttcgtggcgtgccgactgatctataagaagtgttaa

DBGET integrated database retrieval system