KEGG   Bos indicus (zebu cattle): 109576848
Entry
109576848         CDS       T04792                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04022  cGMP-PKG signaling pathway
biu04141  Protein processing in endoplasmic reticulum
biu04151  PI3K-Akt signaling pathway
biu04211  Longevity regulating pathway
biu04261  Adrenergic signaling in cardiomyocytes
biu04668  TNF signaling pathway
biu04728  Dopaminergic synapse
biu04911  Insulin secretion
biu04915  Estrogen signaling pathway
biu04918  Thyroid hormone synthesis
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu05020  Prion disease
biu05030  Cocaine addiction
biu05031  Amphetamine addiction
biu05034  Alcoholism
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109576848 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109576848 (ATF6B)
   04022 cGMP-PKG signaling pathway
    109576848 (ATF6B)
   04151 PI3K-Akt signaling pathway
    109576848 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109576848 (ATF6B)
   04915 Estrogen signaling pathway
    109576848 (ATF6B)
   04926 Relaxin signaling pathway
    109576848 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    109576848 (ATF6B)
   04918 Thyroid hormone synthesis
    109576848 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    109576848 (ATF6B)
   04925 Aldosterone synthesis and secretion
    109576848 (ATF6B)
   04927 Cortisol synthesis and secretion
    109576848 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109576848 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    109576848 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    109576848 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109576848 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    109576848 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    109576848 (ATF6B)
   05031 Amphetamine addiction
    109576848 (ATF6B)
   05034 Alcoholism
    109576848 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109576848 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109576848 (ATF6B)
   05161 Hepatitis B
    109576848 (ATF6B)
   05163 Human cytomegalovirus infection
    109576848 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109576848 (ATF6B)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109576848 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF4407 GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 109576848
NCBI-ProteinID: XP_019841038
LinkDB
Position
23
AA seq 723 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDSTLYAGLDEVAEEQTELFRCPEQDVPVSLPKP
CLSPLFGSSSLDLGMDVSPPEPPWDSLPIFPARFPPDLQVKSEPSSPCSSSSLSSESSHL
STEPSNQAPGVGEMLVVKSESLAPPLCLLGDDPTSPFETIQINVSTXSDDPSDVQIKIEP
ASPSSSINSEAPLLSAESPSQAFIGEEVLEVKTESPSPQGCLLRDVPGPXPGAVQISMGL
SSDGSSGKALPARKPPLQPKPMLITTVPIPPRAVPXSTTVLLQPLVQPPPVSPVVLIQGT
VRVQPEGPTPPPPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKK
EYLQGLEARLQAVLADNQQLRRENAALRRRLEALLTENSELKLGSGNRKVVCVMVFLLFI
AFNFGPVSISEPPPASISPRMSRGESRPRRHLLEFSAQEPVHGAEPRQHPFQDPEEPQPS
PAGHPSFRNLTAFPGDTRELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGR
RKTPQRAQEKQKSQFRKKSPPVQAVPTRPPGPPEGDSVGQLQLYRQPDRSQPEFLDAIDR
REDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGPPGDYEEMMQIEC
EVMDTRVIHIKTSTVPPSLRKQPSSTPGNATGGPLPASAAASQAHQAAHQPSTSIISDLY
DSH
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggcggagctgatgcttctcagcgagattgcggacccgacacgctttttcaccgacaac
ttgctgagcccggaggactgggacagcactttgtacgccggcttggaygaagtggccgag
gagcagacggagctcttccgttgtccggagcaagatgtcccggtatcgctccccaagcct
tgtctctcaccgttgtttggcagcagctctctggacctgggaatggacgtcagccctcct
gaacccccctgggactctctgcctatcttcccagcccgttttcctccagatctccaggtg
aagtctgagccatcctccccctgctcttcctcctccctcagctctgaatcatcgcatctt
tccacagagccctccaaccaggcccctggtgtaggggagatgctggttgtgaagtcagag
tccttggcacccccactctgcctcctgggagatgatccaacatccccatttgaaaccatc
cagatcaatgtcagcaccayctctgatgatccttcagatgttcagattaagatagagcct
gcctctccatcttcctccatcaactcggaggctcccctgctctctgcagagtcccccagc
caggctttcataggagaggaggtcctggaagtgaagacagagtccccgtcccctcagggg
tgtctcctgcgggatgtccccggccccyctcctggagctgtccagatcagcatgggcctg
tcctctgacggctcctcaggcaaagccctgccygcccggaagccaccactgcagcccaaa
cccatgctgataaccactgtcccgatacccccgagagctgtgcctrccagcaccaccgtc
ctcttgcagccccttgtccagccacccccagtgtccccagttgtcctcatccaaggtact
gttcgagtccagcctgagggaccgacccctcctcctccacggcctgagaggaagagcatt
gttccagcccctatgcctgggaactcctgccctcctgaggtggatgccaagctgctgaag
cggcagcagcggatgatcaagaaccgggagtcagcctgccagtcccgcaggaagaagaaa
gagtacctgcaggggctggaagcccggctgcaagccgtgctggccgacaaccagcagctc
cggcgggagaatgctgccctccgccggcggctggaggccctgctgactgagaacagcgag
ctcaagttagggtctggaaacaggaaggtggtctgcgtcatggtcttccttctcttcatc
gctttcaactttgggcctgtgagcatcagtgagcctcctccggcttccatctctcctcgg
atgagcagaggggagtctcgaccccggagacacttgctggagttctcggcacaagagcca
gttcatggagccgagccccgccagcatcccttccaggaccctgaggagccccagcccagc
cccgctggccacccaagtttcaggaacctgacagccttccctggggacaccagggagctg
ctgctgagagacctggaccagctcttcctctcctcggattgccggcactttaaccgaacc
gagtccctgaggcttgctgacgagctgagtggctgggtccagcgycaccagagaggccgg
cggaagacacctcagagagcccaggagaaacagaagtctcagtttcggaagaagtctcct
ccagttcaggcagtccccacccgcccccctgggcccccggaaggggattccgtgggccag
ctgcagctgtaccgccaaccagaccgttcgcagcccgagttcctggatgcaattgaccga
cgggaagacacattttacgttgtctccttccgaagggaccacttgctgctcccagccatc
agccacaacaagacctcccggcccaagatgtcyctggtgatgcctgctatggcccccaat
gagaccctgtcaggccggggaccccctggggactatgaggagatgatgcagatcgagtgt
gaggtcatggataccagggtgattcacatcaagacctccacagtgcccccctcgctacga
aaacagccgtcctcaaccccgggcaatgccacaggtggccccttgccagcttctgcagca
gccagccaggctcaccaggctgcccatcagccctctacctcaatcatctctgacctctat
gactcacactga

DBGET integrated database retrieval system