KEGG   Bos indicus (zebu cattle): 109576924
Entry
109576924         CDS       T04792                                 

Gene name
SRF
Definition
(RefSeq) serum response factor
  KO
K04378  serum response factor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04022  cGMP-PKG signaling pathway
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109576924 (SRF)
   04022 cGMP-PKG signaling pathway
    109576924 (SRF)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109576924 (SRF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109576924 (SRF)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box responders to external signals
    109576924 (SRF)
SSDB
Motif
Pfam: SRF-TF
Other DBs
NCBI-GeneID: 109576924
NCBI-ProteinID: XP_019841125
UniProt: A0A6P5DVN3
LinkDB
Position
23
AA seq 509 aa
MLPSQAGAAAALGRGSALGGSLNRTPTGRPGGGGGGTRGANGGRVPGNGAGLGPGRLERE
AAAAATTTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMELGVVVGGPEAAAA
ATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLT
GTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSAT
GFEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPI
TNYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQA
IQVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAP
TSGLADGSLTVLNAFSQAPSTMQVSHSQVQEQGGVPQVFLTAPSGTVQIPVSAVQLHQMA
VIGQQAGSSSNLTELQVVNLDAAHSTKSD
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgttaccgagccaagctggggccgcggcggcgctgggccggggctcagccctggggggc
agcctgaaccggacgccgacggggcggccgggcggtggaggcggcgggactcgaggggct
aacgggggccgggtccccgggaacggcgcggggctcgggccgggccgccttgagcgggag
gctgcagcagcagcgacaaccaccccggcgcccaccgcaggggccctctacagcggcagc
gagggtgactcggagtcgggcgaagaggaggagctgggcgccgagcggcgcggcctgaag
cggagcctgagcgagatggagctcggtgtggtggtcggtgggcccgaggcggcggcggcg
gccacggggggctacgggccggtgagcggcgcggtgagcggggccaagccgggtaagaag
actcggggccgcgtgaagatcaagatggagttcatcgacaacaagctgcggcgctacacg
accttcagcaagaggaagacgggcatcatgaagaaggcctatgagctgtccacgctgaca
gggacacaggtgctgttgctggtggccagtgagacaggccatgtgtatacctttgccacc
cgcaaactgcagcccatgatcaccagtgagactggcaaggcactgattcagacctgcctc
aactcgccagactctccaccccgctcagaccccaccacagaccagagaatgagtgccacc
ggctttgaagagacagacctcacctaccaggtgtcggagtccgacagcagtggggagacc
aaggatacactgaagccggcgtttaccgtcaccaacctgccgggtaccacctccaccatc
cagacagcacccagcacctctaccaccatgcaagtcagcagcggcccctcctttcccatc
accaactacctggcaccagtgtctgctagcgtcagccccagcgctgtcagcagtgccaac
gggactgtgctgaagagtacgggcagtggccccgtttcctccggaggcctcatgcagctg
cctaccagcttcaccctcatgcccggtggggcagtggcccagcaggtcccagtgcaggcc
attcaggtgcaccaggccccacagcaagcgtctccctctcgcgacagcagcacagacctc
acgcagacctcctccagcgggacagtgacgttgcctgccaccatcatgacgtcatctgtg
cccacaactgtgggcggccacatgatgtaccccagcccccatgcggtgatgtatgcgccc
acctcgggcctggctgatggcagcctcactgtgctcaatgccttctcccaggcgccatcc
accatgcaggtgtcccacagccaggtccaggagcaaggtggcgtcccccaggtgttcctc
acagcaccatctgggacagtgcagatcccagtttctgcagttcagcttcaccagatggct
gtgatagggcagcaggccgggagcagcagcaacctcaccgaattacaggtggtgaacctg
gatgccgcccacagcaccaagagtgactga

DBGET integrated database retrieval system