KEGG   Bos indicus (zebu cattle): 109577238Help
Entry
109577238         CDS       T04792                                 

Gene name
ADPRH
Definition
(RefSeq) ADP-ribosylarginine hydrolase
  KO
K01245  ADP-ribosylarginine hydrolase [EC:3.2.2.19]
Organism
biu  Bos indicus (zebu cattle)
Brite
KEGG Orthology (KO) [BR:biu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109577238 (ADPRH)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.19  [protein ADP-ribosylarginine] hydrolase
     109577238 (ADPRH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADP_ribosyl_GH c-SKI_SMAD_bind
Motif
Other DBs
NCBI-GeneID: 109577238
NCBI-ProteinID: XP_019841696
LinkDB All DBs
Position
1
AA seq 353 aa AA seqDB search
MCGALMERYVAAMVLSAAGDALGYFNGKWEFLQNGEKIHRQLAQLGGLDAIDVERWRVSD
DTVMHLATAEALLEAGKVSDLTHLYSLLAKHYQDCMGDMDGRAPGGASVQNAMLLEPDKA
DGWRIPFNSHEGGCGAAMRAMCIGLRFPHSSQLDSLIQVSIESGRMTHHHPTGYLGALVS
ALFTAYAVNGKPPQQWGRGLMEVLPEAKKYIVQSGXFVEQNLQHWSYFQDQWEKYLKLRG
IWDGKSAPTFPKPFDVKERDQFYSSVSYSGXGGSSGHDAPMIAYDAILAAGDSWKELAHR
AFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggggccctgatggagaggtatgtggcagccatggtgctgagtgcagctggagat
gccttgggatacttcaatggaaagtgggagttcctccagaatggggagaaaattcacagg
cagctggcccagcttggtggcttggatgccatagatgtggagaggtggagagtcagcgat
gacaccgtgatgcacctggccacagcagaagcactcctggaagctggcaaagtctcagac
ttgactcacttgtattccctccttgctaagcattaccaggactgcatgggagacatggat
ggccgggcaccagggggtgcctcagtgcagaacgccatgctgctggagccagacaaagcc
gatggctggaggattccctttaacagtcatgagggtggctgcggggccgccatgagggcc
atgtgcattggtctccggttccctcacagcagtcagctggactcactgatccaggtgagc
atcgagagcggccggatgacccatcaccatcccacaggctacctgggagcccttgtgtct
gctctttttacagcctatgctgtgaacggcaagcctccccagcagtggggaagaggactg
atggaggtacttccggaagctaaaaagtacattgtccaatcaggctwctttgtggagcag
aatcttcaacactggtcttacttccaagaccagtgggaaaagtacctaaaactcagagga
atttgggatggcaaatcagcccctaccttccccaagccctttgatgtgaaggaaagggat
cagttctacagttctgtgagctactctggctgsggcggcagcagtggacacgatgccccc
atgattgcctatgatgccatcctggctgcaggagactcctggaaggagcttgcccaccga
gcatttttccacggtggagacagtgattctaccgctgcaattgctggctgttggtgggga
gtgatgtatggttttaaaggagtaagtccctccaactatgagaagctagaatacagaaac
cggctggaagagacagctagggctttgtattctcttaggtaa

DBGET integrated database retrieval system