KEGG   Bos indicus (zebu cattle): 109577247
Entry
109577247         CDS       T04792                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu01524  Platinum drug resistance
biu04012  ErbB signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04110  Cell cycle
biu04115  p53 signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04218  Cellular senescence
biu04630  JAK-STAT signaling pathway
biu04921  Oxytocin signaling pathway
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05216  Thyroid cancer
biu05217  Basal cell carcinoma
biu05218  Melanoma
biu05219  Bladder cancer
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109577247 (CDKN1A)
   04630 JAK-STAT signaling pathway
    109577247 (CDKN1A)
   04066 HIF-1 signaling pathway
    109577247 (CDKN1A)
   04068 FoxO signaling pathway
    109577247 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    109577247 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109577247 (CDKN1A)
   04115 p53 signaling pathway
    109577247 (CDKN1A)
   04218 Cellular senescence
    109577247 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109577247 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    109577247 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109577247 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    109577247 (CDKN1A)
   05206 MicroRNAs in cancer
    109577247 (CDKN1A)
   05205 Proteoglycans in cancer
    109577247 (CDKN1A)
   05203 Viral carcinogenesis
    109577247 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109577247 (CDKN1A)
   05212 Pancreatic cancer
    109577247 (CDKN1A)
   05225 Hepatocellular carcinoma
    109577247 (CDKN1A)
   05226 Gastric cancer
    109577247 (CDKN1A)
   05214 Glioma
    109577247 (CDKN1A)
   05216 Thyroid cancer
    109577247 (CDKN1A)
   05220 Chronic myeloid leukemia
    109577247 (CDKN1A)
   05217 Basal cell carcinoma
    109577247 (CDKN1A)
   05218 Melanoma
    109577247 (CDKN1A)
   05211 Renal cell carcinoma
    109577247 (CDKN1A)
   05219 Bladder cancer
    109577247 (CDKN1A)
   05215 Prostate cancer
    109577247 (CDKN1A)
   05213 Endometrial cancer
    109577247 (CDKN1A)
   05224 Breast cancer
    109577247 (CDKN1A)
   05222 Small cell lung cancer
    109577247 (CDKN1A)
   05223 Non-small cell lung cancer
    109577247 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109577247 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577247 (CDKN1A)
   05161 Hepatitis B
    109577247 (CDKN1A)
   05160 Hepatitis C
    109577247 (CDKN1A)
   05163 Human cytomegalovirus infection
    109577247 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109577247 (CDKN1A)
   05169 Epstein-Barr virus infection
    109577247 (CDKN1A)
   05165 Human papillomavirus infection
    109577247 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109577247 (CDKN1A)
   01522 Endocrine resistance
    109577247 (CDKN1A)
SSDB
Motif
Pfam: CDI MTA_R1
Other DBs
NCBI-GeneID: 109577247
NCBI-ProteinID: XP_019841681
LinkDB
Position
23
AA seq 216 aa
MEVLLRTSRAGSRGPDALGHSGAAGWKGPESLNHRHTWRSATCQPEQLYSLSTGAMSELS
RDAHQIPRSSKACRCLFGPVDSEQLRQDCDALMASCVQEARERWNFDFVTETPLEGDFAW
ERVRGLGLPKLYLPVGPRDDLGGGKRPSPSSAXLQGTSQEDHLDLSLSCTLVTRSPERPE
GTPGGPGPSQGRKRRQTSMTDFYHSKRRLICSKRKP
NT seq 651 nt   +upstreamnt  +downstreamnt
atggaagttctgctgagaacttctagagctggaagcagaggtcctgatgcccttgggcat
agtggagctgcaggatggaaagggcctgagtccctgaatcatcgtcacacctggaggtca
gctacttgccaaccagaacaactgtattcattatccacaggtgccatgtctgagctgtcc
agggacgcgcatcaaatcccccgcagcagcaaggcctgccgctgcctctttggtccagtg
gacagcgagcagctgcgccaggactgcgacgccctcatggccagctgcgtgcaggaggcc
cgagagcggtggaacttcgactttgtcaccgagacgccgctggagggggacttcgcctgg
gagcgcgtgaggggcctcggcctgcccaagctctacctgcccgtggggccccgagacgac
ctgggagggggcaagcggccgagcccctcatccgccnngctgcagggcacgtctcaggag
gaccacttggacctgtcgctgtcctgcaccctcgtgactcgctcccccgagcggcccgag
gggacccccggtgggcctggcccctcccagggccggaaacggcggcagaccagcatgaca
gatttctaccactccaaacgcagrctgatctgctccaagaggaagccctaa

DBGET integrated database retrieval system