KEGG   Bos indicus (zebu cattle): 109577351
Entry
109577351         CDS       T04792                                 

Gene name
PIM1
Definition
(RefSeq) serine/threonine-protein kinase pim-1
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04630  JAK-STAT signaling pathway
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109577351 (PIM1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109577351 (PIM1)
   05206 MicroRNAs in cancer
    109577351 (PIM1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109577351 (PIM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109577351 (PIM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109577351 (PIM1)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109577351 (PIM1)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   109577351 (PIM1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH Seadorna_VP7 Choline_kinase
Other DBs
NCBI-GeneID: 109577351
NCBI-ProteinID: XP_019841825
UniProt: A0A6P5DXN4
LinkDB
Position
23
AA seq 313 aa
MLLSKINSLAHLRAAPCSDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVAD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHDCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIVRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
NT seq 942 nt   +upstreamnt  +downstreamnt
atgctcttgtccaaaatcaactcgcttgcccacctgcgcgccgcgccctgcagcgacctg
cacgccaccaagctggcgccgggcaaggagaaggagcccctggagtcgcagtaccaggtg
ggcccgctcctgggcagtggcggcttcggctcggtgtactcaggcatccgtgtcgccgac
aacttgccggtggccatcaagcacgtggagaaggaccggatttccgactggggagagctg
cctaatggcacccgagtgcccatggaagtggttctgctgaagaaggtgagctcgggcttc
tccggcgtcattaggctcctggactggttcgagaggcccgacagtttcgtcctgatcctg
gagaggccggagccggtgcaagacctcttcgactttatcacggaaaggggggctctgcag
gaggagctggcccgcagcttcttctggcaggtgctggaggcggtgcgacactgccacgac
tgcggggtgcttcaccgcgacatcaaggacgagaacatccttatcgacctcaatcgcggc
gagctcaagctcatcgacttcgggtcgggggcgctgctcaaggacaccgtctacacggac
ttcgatgggacccgagtgtatagtcctccagagtggatccgctatcatcgctaccatggc
aggtcggcagccgtctggtctctggggatcctgctgtatgacatggtgtgcggagatatt
ccctttgagcacgatgaggagattgtcaggggccaagttttcttcaggcagcgggtctcc
tcagagtgtcaacatctcattagatggtgcttggccttgagaccatcagatcggccaacc
ttcgaagaaatccagaaccatccgtggatgcaagacgtcctcctgccccaggaaactgct
gagatccatctccacagcctgtcgccagggcccagcaaatag

DBGET integrated database retrieval system