Bos indicus (zebu cattle): 109577428 Help Entry 109577428         CDS       T04792                                  Gene name TNF Definition (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism biu  Bos indicus (zebu cattle) Pathway biu01523   Antifolate resistance biu04010   MAPK signaling pathway biu04060   Cytokine-cytokine receptor interaction biu04061   Viral protein interaction with cytokine and cytokine receptor biu04064   NF-kappa B signaling pathway biu04071   Sphingolipid signaling pathway biu04150   mTOR signaling pathway biu04210   Apoptosis biu04217   Necroptosis biu04350   TGF-beta signaling pathway biu04380   Osteoclast differentiation biu04612   Antigen processing and presentation biu04620   Toll-like receptor signaling pathway biu04621   NOD-like receptor signaling pathway biu04622   RIG-I-like receptor signaling pathway biu04625   C-type lectin receptor signaling pathway biu04640   Hematopoietic cell lineage biu04650   Natural killer cell mediated cytotoxicity biu04657   IL-17 signaling pathway biu04660   T cell receptor signaling pathway biu04664   Fc epsilon RI signaling pathway biu04668   TNF signaling pathway biu04920   Adipocytokine signaling pathway biu04930   Type II diabetes mellitus biu04931   Insulin resistance biu04932   Non-alcoholic fatty liver disease biu04933   AGE-RAGE signaling pathway in diabetic complications biu04940   Type I diabetes mellitus biu05010   Alzheimer disease biu05014   Amyotrophic lateral sclerosis biu05020   Prion disease biu05022   Pathways of neurodegeneration - multiple diseases biu05132   Salmonella infection biu05133   Pertussis biu05134   Legionellosis biu05135   Yersinia infection biu05140   Leishmaniasis biu05142   Chagas disease biu05143   African trypanosomiasis biu05144   Malaria biu05145   Toxoplasmosis biu05146   Amoebiasis biu05152   Tuberculosis biu05160   Hepatitis C biu05161   Hepatitis B biu05163   Human cytomegalovirus infection biu05164   Influenza A biu05165   Human papillomavirus infection biu05166   Human T-cell leukemia virus 1 infection biu05168   Herpes simplex virus 1 infection biu05169   Epstein-Barr virus infection biu05170   Human immunodeficiency virus 1 infection biu05171   Coronavirus disease - COVID-19 biu05205   Proteoglycans in cancer biu05310   Asthma biu05321   Inflammatory bowel disease biu05322   Systemic lupus erythematosus biu05323   Rheumatoid arthritis biu05330   Allograft rejection biu05332   Graft-versus-host disease biu05410   Hypertrophic cardiomyopathy biu05414   Dilated cardiomyopathy biu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109577428 (TNF)    04350 TGF-beta signaling pathway     109577428 (TNF)    04064 NF-kappa B signaling pathway     109577428 (TNF)    04668 TNF signaling pathway     109577428 (TNF)    04071 Sphingolipid signaling pathway     109577428 (TNF)    04150 mTOR signaling pathway     109577428 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109577428 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     109577428 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     109577428 (TNF)    04217 Necroptosis     109577428 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     109577428 (TNF)    04620 Toll-like receptor signaling pathway     109577428 (TNF)    04621 NOD-like receptor signaling pathway     109577428 (TNF)    04622 RIG-I-like receptor signaling pathway     109577428 (TNF)    04625 C-type lectin receptor signaling pathway     109577428 (TNF)    04650 Natural killer cell mediated cytotoxicity     109577428 (TNF)    04612 Antigen processing and presentation     109577428 (TNF)    04660 T cell receptor signaling pathway     109577428 (TNF)    04657 IL-17 signaling pathway     109577428 (TNF)    04664 Fc epsilon RI signaling pathway     109577428 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     109577428 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     109577428 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     109577428 (TNF)   09163 Immune disease    05310 Asthma     109577428 (TNF)    05322 Systemic lupus erythematosus     109577428 (TNF)    05323 Rheumatoid arthritis     109577428 (TNF)    05321 Inflammatory bowel disease     109577428 (TNF)    05330 Allograft rejection     109577428 (TNF)    05332 Graft-versus-host disease     109577428 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     109577428 (TNF)    05014 Amyotrophic lateral sclerosis     109577428 (TNF)    05020 Prion disease     109577428 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     109577428 (TNF)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     109577428 (TNF)    05410 Hypertrophic cardiomyopathy     109577428 (TNF)    05414 Dilated cardiomyopathy     109577428 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     109577428 (TNF)    04940 Type I diabetes mellitus     109577428 (TNF)    04932 Non-alcoholic fatty liver disease     109577428 (TNF)    04931 Insulin resistance     109577428 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     109577428 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     109577428 (TNF)    05135 Yersinia infection     109577428 (TNF)    05133 Pertussis     109577428 (TNF)    05134 Legionellosis     109577428 (TNF)    05152 Tuberculosis     109577428 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109577428 (TNF)    05170 Human immunodeficiency virus 1 infection     109577428 (TNF)    05161 Hepatitis B     109577428 (TNF)    05160 Hepatitis C     109577428 (TNF)    05171 Coronavirus disease - COVID-19     109577428 (TNF)    05164 Influenza A     109577428 (TNF)    05168 Herpes simplex virus 1 infection     109577428 (TNF)    05163 Human cytomegalovirus infection     109577428 (TNF)    05169 Epstein-Barr virus infection     109577428 (TNF)    05165 Human papillomavirus infection     109577428 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     109577428 (TNF)    05144 Malaria     109577428 (TNF)    05145 Toxoplasmosis     109577428 (TNF)    05140 Leishmaniasis     109577428 (TNF)    05142 Chagas disease     109577428 (TNF)    05143 African trypanosomiasis     109577428 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     109577428 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:biu04052]     109577428 (TNF)    00536 Glycosaminoglycan binding proteins [BR:biu00536]     109577428 (TNF) Cytokines and growth factors [BR:biu04052]  Cytokines   Tumor necrosis fators    109577428 (TNF) Glycosaminoglycan binding proteins [BR:biu00536]  Heparan sulfate / Heparin   Cytokines    109577428 (TNF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  109577428 NCBI-ProteinID:  XP_019841916 UniProt:  A0A6P5DUH5 LinkDB All DBs Position 23 AA seq 333 aa AA seqDB search MGFSTKEVFRWLNESLSPPSSHPTAYKCSCLHTQPTEAPRAGTPGDQPGERQAAAEPPGD NLPDNTPPRDSQATCSLSHTLPQGSPVSRLDLNPSEKDTMSTKSMIRDVELAEEVLSEKA GGPQGSRSCLCLSLFSFLLVAGATTLFCLLHFGVIGPQREEQSPGGPSINSPLVQTLRSS SQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLF RGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVF QLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt atgggtttctccaccaaggaagttttccgctggttgaatgagagcctttccccgccctct tctcaccccacagcatataaatgcagctgtttgcacacccagccaacagaagctcccaga gcggggacaccaggggaccagccaggagagagacaagcagctgcagaaccccctggagat aacctcccagacaacacacccccgagagacagccaggcaacttgctctctctcacatacc ctgccacaaggctctcctgtctcccgtctggacttgaacccttctgaaaaagacaccatg agcaccaaaagcatgatccgggatgtggagctggcggaggaggtgctctccgagaaagca gggggcccccagggctccagaagttgcttgtgcctcagcctcttctccttcctcctggtt gcaggagccaccacgctcttctgcctgctgcacttcggggtaatcggcccccagagggaa gagcagtccccaggtggcccctccatcaacagccctctggttcagacactcaggtcctct tctcaagcctcaagtaacaagccggtagcccacgttgtagccgacatcaactctccgggg cagctccggtggtgggactcgtatgccaatgccctcatggccaacggtgtgaagctggaa gacaaccagctggtggtgcctgctgacgggctttacctcatctactcacaggtcctcttc aggggccaaggctgcccttccacccccttgttcctcacccacaccatcagccgcattgca gtctcctaccagaccaaggtcaacatcctgtctgccatcaagagcccttgccacagggag accccagagtgggctgaggccaagccctggtacgaacccatctaccagggaggagtcttc cagctggagaagggagatcgcctcagtgctgagatcaacctgccggactacctggactat gccgagtctgggcaggtctactttgggatcatcgccctgtga

DBGET integrated database retrieval system