KEGG   Bos indicus (zebu cattle): 109577691Help
Entry
109577691         CDS       T04792                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00250  Alanine, aspartate and glutamate metabolism
biu00410  beta-Alanine metabolism
biu00430  Taurine and hypotaurine metabolism
biu00650  Butanoate metabolism
biu01100  Metabolic pathways
biu04727  GABAergic synapse
biu04940  Type I diabetes mellitus
Module
biu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109577691
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109577691
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109577691
   00430 Taurine and hypotaurine metabolism
    109577691
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    109577691
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    109577691
Enzymes [BR:biu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109577691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase Hydrophob_seed SepSecS
Motif
Other DBs
NCBI-GeneID: 109577691
NCBI-ProteinID: XP_019842004
LinkDB All DBs
Position
24
AA seq 633 aa AA seqDB search
MPRHKACCNTHAEPPRRRQHTXMCQSXPRGLRERVTMEVVSQRPLGASQEKSTGKSSEWL
RLDGWCCSLVRSVPDSLAAHGCCCQSVSTDVIDLVQARLHFNSVKFNLELFVALSPYSKI
MLQNVGFEKINRPCLFLFSLDLLPSKEGEDLTKCFLLRVVNILLHYIEKTFDDKSKILDF
HHPHQLLEGLDGFDLELSDHPESLEQLLVDCTDTLKYGVKTGHPRYFNQLSSGLDVIGLA
GEWLTATANTNMFTYEIAPVFTVMETVLLKKMCGIIGWRETEADGIFSPGGSISNLYGIL
VARYKQYPEIKARGMAVLPCIVLFVSEQGHYSIKKAAATLGIGTDNVIEVKCDERGKMIP
AELEKNILQAKRKGQTPFCVVATAGSTVFGAFDPLHDIADICETHKLWMHVDAAWGGGLL
LSRKHSCRLSGIERADSVTWNPHKLMGVPLQCSALLTREKGLLGACNQMQAEYLFQPDKV
YNINFDTGDKTIQCGRHVDVFKLWLMWKAKGTYGFEVQIDRYMELAKYFYKVLKKKDNFK
LVFDAEPEFTNVCFWYFPPRLKHIPKSFERDQELQKIAPKIKAQMIVEGTAMLSYQPCGD
KVNFFRMVFSNPATRQTDVDYLIDEIQRLGKDL
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgccccgacacaaagcctgttgcaacacgcacgcagagccaccccggagacgccagcac
acagygatgtgtcagagcstgccacgcggattgcgagagcgcgtcacgatggaggtggtg
tcacagcgccccctgggagcgtctcaggagaagtccactgggaagagttccgagtggctt
cgtctggatgggtggtgctgctctttagtcaggagtgtgcctgactccttagccgcccac
ggatgctgctgtcagtcagttagtacagatgttatagatctggttcaggccaggttacac
tttaactctgtgaaattcaacttggaattatttgttgctcttagtccgtattctaaaatc
atgcttcaaaatgtaggctttgagaaaataaaccgaccttgtttatttcttttttctcta
gatttgttgccatccaaggagggcgaagatttaacaaaatgttttctgctgcgagtggta
aatattcttctgcactacattgagaaaactttygatgataagagtaaaatattggacttt
catcatcctcatcaacttcttgaaggtttggatgggtttgacttagaactgtctgaccat
cctgaatctctggagcagttgctggttgattgcacagacaccttaaaatatggggtaaaa
acaggacatcctcgctattttaaccagctctccagtgggctagatgtgatcggacttgca
ggggaatggttgacagccactgcaaataccaacatgtttacctatgaaatagctccagta
tttactgtcatggaaacagttcttcttaagaaaatgtgtggaattattggctggagagaa
acagaagcagatggaatattttcacctggtgggagtatatcaaacctctatggtatatta
gtagctcgttataagcaatatccagagataaaagcaagaggcatggcagtccttccgtgc
atcgtattgtttgtttctgaacaaggtcattattccataaaaaaggctgcagcaactctt
ggtattggracagataatgtaattgaagtaaaatgtgatgaaaggggaaagatgattcca
gctgagttagagaaaaatatattacaagctaaaagaaagggccagactcctttctgtgtt
gtggccacagctggcagcaccgtattcggggccttcgacccgctccatgacatcgcagat
atttgtgagacacacaagctctggatgcatgtggatgcagcttggggaggtggattgctg
ttgtccagaaagcattcctgtagactcagtggcattgaaagggccgactccgtgacctgg
aacccccacaaactcatgggtgtgccccttcagtgctctgctctcctgacccgggaaaaa
ggtcttctgggagcgtgcaaccagatgcaggctgaatacctcttccagcctgataaagtc
tacaatattaactttgacaccggggataagacgattcaatgcggccgacatgtcgatgtc
tttaagctctggttaatgtggaaggcaaagggaacctatgggtttgaggtacagattgac
agatatatggaacttgcaaaatacttctataaagttttaaagaaaaaagataactttaag
cttgtatttgacgcagagcctgagttcacgaatgtctgcttctggtatttcccaccaaga
cttaaacatatcccaaaaagttttgaaagagatcaagaactgcaaaagattgctccgaag
attaaagctcagatgatagtggagggtacagccatgctcagctaccagccctgtggggac
aaagtaaattttttccgaatggtcttttctaatcctgccacaagacaaacagatgttgac
tatcttattgatgaaattcaaagacttgggaaagatttatga

DBGET integrated database retrieval system