KEGG   Bos indicus (zebu cattle): 109577834
Entry
109577834         CDS       T04792                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04068  FoxO signaling pathway
biu04110  Cell cycle
biu04310  Wnt signaling pathway
biu04350  TGF-beta signaling pathway
biu04371  Apelin signaling pathway
biu04390  Hippo signaling pathway
biu04520  Adherens junction
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04659  Th17 cell differentiation
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05161  Hepatitis B
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05220  Chronic myeloid leukemia
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109577834 (SMAD4)
   04350 TGF-beta signaling pathway
    109577834 (SMAD4)
   04390 Hippo signaling pathway
    109577834 (SMAD4)
   04371 Apelin signaling pathway
    109577834 (SMAD4)
   04068 FoxO signaling pathway
    109577834 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109577834 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109577834 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    109577834 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109577834 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109577834 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109577834 (SMAD4)
   05212 Pancreatic cancer
    109577834 (SMAD4)
   05225 Hepatocellular carcinoma
    109577834 (SMAD4)
   05226 Gastric cancer
    109577834 (SMAD4)
   05220 Chronic myeloid leukemia
    109577834 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109577834 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577834 (SMAD4)
   05161 Hepatitis B
    109577834 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 109577834
NCBI-ProteinID: XP_019842269
UniProt: A0A6P5DWD9
LinkDB
Position
24
AA seq 553 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATGTTNFPTIPVAPTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGG
DRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAG
RAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIA
PAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEV
LHTMPIADPQPLD
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacattcgccaaaagagcaatt
gaaagtttagttaaaaagctgaaggagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcaccctagcaagtgtgttaccatacagagaacattggatgga
aggcttcaggtggctggtcgcaagggatttcctcatgtgatctatgcccgtctctggagg
tggcctgaccttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgaacgagttgtrtcacctgga
attgatctctcaggattaacactgcagagtaatgctccaccaagtatgttggtgaaggat
gaatatgttcatgactttgagggacagccatcattatccactgaagggcattcaattcaa
accatccagcatccaccaagtaatcgtgcatcgacggagacatacagcaccccagctctc
ttagctccatctgagtctaatgccaccggcaccaccaatttycccaccattcctgtggct
cccacaagtcagcccgccagtatactggcaggcagccatagtgaaggattgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttat
catcataacagcactaccacctggacgggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatctccagcaccacccgcctatgccgccccatcccggacat
tactggccaccagttcacaatgagcttgcattccagcctcctatttctaatcatcctgct
cctgagtattggtgttccattgcttactttgagatggatgttcaagtaggagagacattt
aaggttccttcaagctgtcctattgttactgttgatggatatgtagacccttctggagga
gatcgcttttgcttgggtcaactctccaatgtccacaggacagaagccattgagagagca
aggttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtc
aggtgccttagtgaccacgcagtctttgtacagagctactacttagacagagaagctggg
cgtgcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgat
ttgcgtcagtgtcaccgtcagatgcagcagcaggcagccacggcacaagctgcagcagct
gcccaggcagcggccgtggcaggaaacatccccggcccagggtcagtaggtggaatagcc
ccagccatcagtttgtcggctgccgccgggatcggtgtggatgacctccgtcgtttatgc
atactcaggatgagttttgtgaaaggctggggacctgattacccaagacagagcatcaag
gaaacaccttgttggattgagattcacttacaccgggccctccagctcctcgatgaagtc
cttcacaccatgcctattgccgacccacagcctttagactga

DBGET integrated database retrieval system