KEGG   Bos indicus (zebu cattle): 109577870
Entry
109577870         CDS       T04792                                 

Gene name
PTPN2
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 2 isoform X1
  KO
K18026  tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109577870 (PTPN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109577870 (PTPN2)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     109577870 (PTPN2)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    109577870 (PTPN2)
SSDB
Motif
Pfam: Y_phosphatase LAP1C DSPc CHASE3 Y_phosphatase3
Other DBs
NCBI-GeneID: 109577870
NCBI-ProteinID: XP_019842366
UniProt: A0A6P5DVM8
LinkDB
Position
24
AA seq 416 aa
MSAAIEREFEELDAQNRWQQLYLEIRSESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTGCHFWLMVWQQKTKAVVMLNRIVEKDS
VKCAQYWPTKDDREMLFKETGFSVKFLSEDVKSYYTVHLLQLGNTRTGETRTISHFHYTT
WPDFGVPESPASFLNFLFKVRESGSLNPEHGPAVIHCSAGIGRSGTFSLVDSCLVLIEKG
DNINIKQLLLNMRKYRMGLIQTPDQLRFSYMTIIEGAKFIKGDSSIQKRWKELSKEDVCP
VFDHSPTKIMTEKYNGNRIGLEEEKLTGDRYSGLSSKTQEAPEESSESALRKRLREDRKA
STAQKVQQMKQRLSETERKRKRWLYWQPILTKMGFVSVILVGAFVGWTLFLQQNAL
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgtcggctgccatcgaacgggagtttgaggagttagacgctcagaatcgctggcagcag
ctgtacctggaaattcgcagtgagtcccatgactatcctcatagagtggccaagttccct
gaaaacagaaatcgaaacagatacagagatgtgagcccatatgatcacagtcgtgttaag
ctgcagaatgctgaaaatgattatattaatgccagcttagttgacatagaggaggcacag
aggagctacatcttaacccagggtccacttcctaatacaggttgtcatttctggctcatg
gtttggcagcaaaagaccaaagcagttgtcatgctaaaccgaattgtggagaaagactcg
gttaaatgtgcacagtactggcctacaaaagatgaccgggagatgctgtttaaggaaacg
ggcttcagcgtgaagttcctgtcagaggacgtgaagtcctattacacagtccatctgttg
cagttaggaaacaccaggactggtgaaaccagaacaatatctcactttcattatactacc
tggccagattttggagtccctgaatcaccagcttcgtttctcaatttcttattcaaagtg
cgggaatctggctccttgaaccctgagcacgggcctgcggtgatccactgcagtgccggc
attgggcggtcagggaccttttcgctggtggacagctgccttgttctgatagaaaaagga
gacaatattaacattaaacaactgttactgaatatgagaaaataccgaatggggctgatt
cagacaccagatcagctcagattttcctacatgactataatagaaggagcgaagtttata
aagggagactcaagtatacagaaacgttggaaagaactttctaaggaagatgtatgtcct
gtttttgatcattcgccaaccaaaataatgactgaaaaatacaatgggaacaggataggc
ctagaagaggaaaaactgacaggagacagatactcaggtctgtcctctaaaacacaggaa
gctccggaggagagcagcgagagtgctctgcgcaagcgcctccgggaggacaggaaggcc
agcaccgcccagaaggtgcagcagatgaagcagaggctgagcgagactgagcgcaagagg
aaaaggtggttatattggcaacctattctcactaagatggggtttgtgtcagtcattctg
gttggcgcttttgttggctggacactgtttcttcagcagaatgccctataa

DBGET integrated database retrieval system