KEGG   Bos indicus (zebu cattle): 109578140
Entry
109578140         CDS       T04792                                 

Gene name
CD19
Definition
(RefSeq) B-lymphocyte antigen CD19
  KO
K06465  B-lymphocyte antigen CD19
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04151  PI3K-Akt signaling pathway
biu04640  Hematopoietic cell lineage
biu04662  B cell receptor signaling pathway
biu05169  Epstein-Barr virus infection
biu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109578140 (CD19)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109578140 (CD19)
   04662 B cell receptor signaling pathway
    109578140 (CD19)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    109578140 (CD19)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109578140 (CD19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109578140 (CD19)
CD molecules [BR:biu04090]
 Proteins
  109578140 (CD19)
SSDB
Motif
Pfam: Ig_3 V-set ig
Other DBs
NCBI-GeneID: 109578140
NCBI-ProteinID: XP_019842698
UniProt: A0A6P5DWE5
LinkDB
Position
25
AA seq 492 aa
MPPPLLFLLLFLTPVGVRPEDPRLVEAKEGGDAVLPCLEGSSAGPPEQLAWFRGSQTTPF
LNLSLGLPGLGIHVGPLGTLKEPQGTLLFLFNVSKHMGGFYLCQPGLSSEQGWQPGWTVS
VQGSGKLFRWNASDLNDPSCDLRNKTSKGPRSSSGHPTKSQLNVWGTDHFKEISHADLPC
APPNSTLNQSDNRGTEAEKQDASLGSSSHSSFPLPVWHWLLETGVWKVPVVTLIYLIFCL
TSLVGFLYLRRALILRRKRKRMTDPNRRFFKVTPPPGNGANSQYGNMLSLSMPHSGTGRA
LRWAAGLGAAAPSYGNPRSDVQEARAAGSRSPPGPGPEEEEGEAYEEPDSEEGSEFYEND
SNLGQDQLSQDGSGYENPEEGSLDPQDEDSFSNGAESYENEDEELAPTVTRTTDLLSPHG
SAWDPSREAASLGSQSYEDMRGILYAAPQLRFVRAQPGANHEEDADSYENMDNPDGPEPA
WGGGARIGWSTR
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgccacctcctctcctctttctcctcctcttccttacccctgtaggagtcaggcccgag
gatccacgcctagtggaggctaaagagggaggcgatgctgtgctgccatgcctcgaaggt
tcctcggctggtccccctgaacaactggcctggtttcggggctcccaaacaacacccttc
ttaaatttgagcctagggttaccaggcctgggcatccatgtggggcctctgggcaccctg
aaggagccccagggaaccctgctgttcctcttcaatgtctccaaacatatggggggcttc
tacctgtgccagccaggcctgtcttctgagcagggctggcagcccggctggacagtcagc
gtgcagggcagcgggaaactgttccggtggaatgcttcagacctcaatgacccaagctgt
gacctgaggaacaaaacctcgaagggccccaggtcctcttctggtcaccccacaaagtcc
cagctgaatgtgtggggcacggaccactttaaggagatctcacacgcagacctgccctgt
gctccacctaacagcacattgaaccagagcgacaaccgtggaactgaggctgaaaagcaa
gatgccagcctgggatcttcatctcatagctccttccccctaccagtatggcattggctg
ctggagactggtgtctggaaagtccctgttgtgactttaatttatctgatcttctgcctg
acttccctggtgggttttctttatcttcgaagagccctgatcctgaggaggaaaagaaag
cgaatgacagatcccaatagaaggttcttcaaagtgacgcctcccccgggaaacggggcc
aacagccagtacggaaacatgctttccctctccatgccccactctggcacgggacgcgcc
ctgcggtgggctgcgggcctcggagccgccgcgccgtcctacggaaacccacgcagcgac
gtccaggaggccagagccgcggggtcccggagcccgccaggacctggcccagaagaagag
gaaggggaggcctacgaggagccggacagtgaagagggctccgagttttacgagaacgac
tccaaccttgggcaggaccaactctcccaggatggcagcggctatgagaaccctgaggaa
gggagcttggatcctcaggatgaagactccttctctaacggagctgagtcttacgagaat
gaagatgaagaactggcccctaccgtcaccaggacaacagacttgctgagcccccatgga
tcagcctgggaccccagcagagaggcagcctcccttgggtcccaatcctatgaggatatg
agagggatcttgtatgcagctccccagctccgcttcgttcgagcccagcctggtgctaat
catgaggaagatgcagactcttatgagaacatggataatcccgatggaccagaaccggca
tggggaggaggggctcgaatagggtggagcactaggtga

DBGET integrated database retrieval system