KEGG   Bos indicus (zebu cattle): 109578279
Entry
109578279         CDS       T04792                                 

Gene name
TSC2
Definition
(RefSeq) tuberin isoform X1
  KO
K07207  tuberous sclerosis 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04072  Phospholipase D signaling pathway
biu04115  p53 signaling pathway
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04211  Longevity regulating pathway
biu04218  Cellular senescence
biu04714  Thermogenesis
biu04910  Insulin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05168  Herpes simplex virus 1 infection
biu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    109578279 (TSC2)
   04151 PI3K-Akt signaling pathway
    109578279 (TSC2)
   04152 AMPK signaling pathway
    109578279 (TSC2)
   04150 mTOR signaling pathway
    109578279 (TSC2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109578279 (TSC2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    109578279 (TSC2)
   04218 Cellular senescence
    109578279 (TSC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109578279 (TSC2)
   04919 Thyroid hormone signaling pathway
    109578279 (TSC2)
  09149 Aging
   04211 Longevity regulating pathway
    109578279 (TSC2)
  09159 Environmental adaptation
   04714 Thermogenesis
    109578279 (TSC2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    109578279 (TSC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109578279 (TSC2)
   05163 Human cytomegalovirus infection
    109578279 (TSC2)
   05165 Human papillomavirus infection
    109578279 (TSC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109578279 (TSC2)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109578279 (TSC2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP Cnd1 Telomere_reg-2
Other DBs
NCBI-GeneID: 109578279
NCBI-ProteinID: XP_019842880
UniProt: A0A6P5E0P1
LinkDB
Position
25
AA seq 1813 aa
MAKPASKDSGLKEKFKILLGLGTPRPNPRSAEGKQTEFIITAEILRELSVECGLNNRIRV
IGQICEVARTKKFEEHAVEALWKAVSDLLQPERPPEARHAVLALLKAIVQGQGDRLGVLR
ALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLEEELADFVLQWMDVGLSSEFLLVL
VNLVKFNSCYLDEYIASMVHMVCLLCVQTVSSVDIEVSLQVLDAVVCYNCLPAESLPLFI
VTLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYHMCRIMEDRAYMEDAPLLRGAVFFVG
MALWGAHRLYSLKNSPTSVLPSFYEAMTCPNEVVSYEIVLSITRLIKKYRRELQAVTWDI
LLNIIERLLQQLQSLDSPELSAIVHDLLSTVEELCDQNEFHGSQERYFELVERCADQRPE
SSLLNLITYRAQSIHPAKDGWIHNLQLLMERFFRNESRSAVRIKVLDVLSFVLLINRQFY
EEELINSVVISQLSHIPEDRDHQVRKLATQLLVDLAEGCHTHHFNSLLDIVEKVIARSLS
PPPELEERDVAAYSASLEDVKTAVLGLLVILQTKLYALPASHATRVYETLVSHIQLHYKH
SYTLPIASSIRLQAFDFLLQLRADSLHRLGLPSKDGLVRFSPYCVCDCLETERSSEKKAG
CPLSPPAGPPGPAPAGPAVRLGSLPYSLLFRVLLQCLKQETDWKVLKLVLSKLPESLRYK
VLIFTSPCSVDQLSAALCSMLSGPKTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYL
DKTRQREMVYCLEQGLIYRCASQCVVALAVCSVEMPDVILKALPVLVVKLTHISATASMA
IPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRC
RLPFRKDFVPYITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIARPPKQGLNNS
PPVKELKESSAADAFRCRSISVSEHVVRRIQTSLTSASLGSADENSMAQADDNLKNLHLE
LTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSLL
GLDSGELQGGPELSSDPSMHVRQTKEAPAKLESQAGQQVYHGARDRVRSMSGGHGLRVGA
LDAPACYFPSSPTSPGSQTAPASQPEKASAGSPLPAQKEKTNLAAYMPLLTQGWAEILVR
RPTGNTSWLMSLENPLSPFSSDINSMPLQELSNALMAAERFKERRDTALYKSLSVPAAGS
AKPSPPPRSNTVASFSSLCQSRCQGKLHRSISWADSAVVLEEGGPGEAGLSAEPPELEDF
EATLGSDGRCGRSDAFSRSSSTSSQEEKSFHAEELPPGGIPIERAVSEGSRASVDLAFQP
SQPLSKSSSSPELQTLQDILGDPGDKAEVGRLSPEAKARSQSGILDGEGAAWSAPGEERR
GRGPAQPEGPLPSSCPRSPSGLRPRGYTISDSAPSRRGKRVERDAFKNRAGTSNTEKVPG
INPSFVFLQLYHSPFFGDESNKPILLPNESFERSVQLLDQIPSYDTHKIAVLYVGEGQSN
SELAILSNEHGSYRYTEFLTGLGKLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQ
AVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIVYNDSGEDFKLGTIKGQFNFVHVIITPL
DYECNLVSLQCRKDMEGLVDTSMAKIVSDRNLPFVARQMALHANMASQVHHSRSNPTDIY
PSKWIARLRHIKRLRQRIREEAHYSSASLPLMQTHPPGHAKAPAQAPAESTPTYETGQRK
RLVSSVDDFTEFV
NT seq 5442 nt   +upstreamnt  +downstreamnt
atggctaagccagcaagcaaagattcaggcttgaaggagaagttcaagattcttttggga
ctggggactccacggccaaatcccaggtctgcagagggcaaacagactgagtttatcatc
accgcggaaatcctgagagagctgagtgttgaatgtggcctcaataatcgcatccgggtg
atagggcagatctgtgaggttgccagaacgaagaaattcgaagagcacgcggtggaagca
ctctggaaggccgtctcggacctgctgcagccagagcggccacccgaggcccggcatgcg
gtgctggctctgctgaaggccatcgtgcaggggcagggggaccgcctgggcgttctcagg
gccctcttcttcaaggtcatcaaggattacccctctaatgaagacctccacgagagactg
gaagttttcaaggccctcacagacaatgggagacacatcacctacttggaagaagagctg
gcggactttgtcctgcagtggatggacgttggcctgtcctccgaattcctcctggtgctc
gtgaacttagtcaaattcaacagctgttaccttgatgagtacatcgcatccatggtccac
atggtctgcctgctgtgtgtccagaccgtgtcctccgtggacatagaggtgtctctgcag
gtgctggatgctgtggtctgctacaactgtctgccagccgagagcctccccctattcatc
gtcactctctgccgcaccatcaacgtcaaggagctctgtgaaccttgctggaagctgatg
cgcaacctcctgggcacccacctgggccacagcgccatctaccacatgtgccgcatcatg
gaagacagagcctacatggaggacgcaccactgctgagaggagccgtgttctttgttggc
atggctctctggggtgcccaccggctctattctctcaagaactccccaacatctgtgttg
ccatcgttttatgaggccatgacctgtccgaatgaggtggtgtcctacgagattgtcctc
tccataaccagactcatcaagaagtacaggagggagctccaggccgtgacctgggacatc
ctgctgaacatcatcgagcgcctgctccagcagctccagagcctggacagcccagagctg
agcgccatcgtgcacgatctgctgagcacagtggaggagctgtgtgaccagaacgagttt
cacggctcccaggagagatactttgaactcgtggagaggtgtgcggaccagaggcctgag
tcatcccttttaaacttaataacctacagggctcagtccatccatccagcgaaggacggc
tggatccacaacctgcagctgctgatggagaggtttttcaggaacgagtcacgcagtgcc
gtgcgcatcaaggtgctggacgtcctgtccttcgtgctgctcatcaacaggcagttctac
gaggaggagcttatcaactcagtggtcatctcgcagctctcccacatccctgaggataga
gaccaccaggtccggaagctggccactcagctgctggtagatctggccgaaggctgccac
acccaccacttcaacagcctgctggacattgttgagaaggtgatcgcccgttccctctct
ccgccccccgagctggaggagagggatgtggccgcgtactcggcctccttggaggatgtg
aagactgcggtcctggggctcctggtcatccttcagactaagctgtatgccctgcctgcc
agccatgccacacgcgtgtacgagacgctggtcagccacattcagctccactacaagcac
agctacaccctgcccatcgccagcagcatccgtctgcaggccttcgacttcctgctgcag
ctgcgggccgactcactgcaccgcctgggcctgcccagcaaagacgggcttgtgaggttc
agcccctactgcgtctgtgactgcctggagacagagaggagctccgagaagaaggccggg
tgccccctgtccccgcccgccgggccccctggccctgcgcctgcgggccctgccgtgcgc
cttgggtccctgccctactccctgctcttccgtgttctgctgcagtgtctgaagcaggag
accgactggaaggtgctgaagctggtgctcagcaaactgcccgagtcgctgcgctataag
gtcctcatcttcacctccccatgcagtgtcgaccagctgtccgccgccctctgctccatg
ctttcaggtcccaagaccctggagcggctccgaggcactccagaaggcttctccagaacc
gacctgcatctcgctgtggttcccgtgctgacagccctgatctcttaccataactacttg
gacaaaactagacagcgggagatggtgtactgcctggagcaaggcctcatctaccgctgt
gccagccagtgtgtggtggccctggccgtgtgcagcgtggagatgcccgacgtcatcctc
aaggcactgcccgtcctggttgtgaagctcacacacatctcggccacggccagcatggcc
atcccgctcctcgagttcctgtccactctggccagactgcctcacctctacaggaacttc
gcagcagagcagtatgccagtgtgtttgccatctccctgccgtataccaacccctccaag
ttcaatcagtacatcgtgtgcctggcccatcacgtcatagccatgtggttcatcaggtgc
cgcctgcccttccggaaggactttgttccttacatcaccaagggtctgcgctccaacgtc
ctcctgtctttcgatgacacccccgagaaggacagcttccgagcgcggagcaccagtctc
aacgagaggcccaagagtttgaggatagccagaccccccaaacaaggcttgaataactct
ccacccgtgaaagaactcaaggagagctctgcagccgatgccttccggtgccgcagcatc
agtgtgtctgaacatgtggtccgcaggatccagacctctctcacgagcgccagcttgggg
tctgcagacgagaactcgatggcccaggccgacgacaacttgaaaaacctccacctggag
ctcacagagacgtgtctggacatgatggccagatatgtgttctccaacttcacggcggtc
cccaagaggtcccccgtgggagagttcctcctggctggtggcaggaccaaaacctggctg
gttgggaacaagcttgtcaccgtgacgacaagcgtggggaccgggacccggtcactgcta
ggcctggactctggagagctgcagggtggcccggagttgagctctgaccccagcatgcat
gtgagacagacaaaggaggcacccgccaagctggagtcccaagctgggcagcaggtgtac
cacggagcccgggaccgggtccgctccatgtccgggggccatggccttcgagtgggtgcc
ttggacgctccagcctgctacttccccagcagccccacgtccccgggctcccagaccgct
ccagccagccagcccgagaaggcctcagctggcagcccgctcccagcacagaaggagaag
acaaacctggccgcttacatgcccctgctgacccagggctgggcagagatcctggtccgc
aggcccacagggaacaccagctggctgatgagcctggagaacccgctcagccccttctcc
tcggacatcaacagcatgccgctgcaggagctgtccaatgccctcatggccgccgagcgc
ttcaaggagcgccgcgacacagccctgtacaagtcgctgtcggtgccggcggccggctca
gccaagccatccccgcccccacgctccaacacagtggcctctttctcctccctgtgccag
tccaggtgccaaggaaagctgcacaggagcatttcctgggcagattctgcggtggtcctg
gaggagggaggtccaggtgaggctggtttgtctgcagagcctcccgagttggaagatttt
gaggcgacactgggctccgacgggcgctgtgggcgcagcgacgctttcagcaggtcatct
tccacctccagccaggaggagaagtcattccatgccgaggagttgcctcctgggggcatc
cccatcgagcgggcggtctcggagggctcccgggcctccgtggacctcgccttccagccc
tctcagcccctgagcaagtccagctcgtcgcctgaactgcagaccctgcaggacatcctg
ggggaccccggggacaaggctgaggttggccggctgagccccgaggccaaggcccggtcg
cagtcagggatcctggacggggaaggtgccgcctggtcagccccgggtgaggaacgccgg
ggtcggggccctgcccagccagagggccccctgccttccagctgtcctcgctcccccagc
gggctgcggccccgaggctacaccatctcggattcggccccgtcacgcaggggcaagagg
gtggagagggatgccttcaagaaccgagcagggacctccaacaccgagaaggtgccaggc
atcaaccccagcttcgtgttcctgcagctctaccactcaccgttctttggtgacgagtcc
aacaagccaatccttttgcctaacgagtctttcgaacgatcagtgcagctccttgatcag
atcccgtcgtacgacacgcacaagatcgcggtcctgtacgtgggagaaggccagagcaac
agcgagctcgccatcctgtccaacgagcatggctcctacaggtacacagagttcctcacg
gggctgggcaagctcatcgagctcaaggactgccagccggacaaggtgtacctgggcggc
ctggacgtgtgcggcgaggatggccagttcacctactgctggcacgacgacatcatgcaa
gctgtcttccacatcgccaccctgatgcccaccaaggacgtggacaagcaccgctgtgac
aagaagcgccacctgggcaacgacttcgtgtccatcgtctacaacgactctggcgaggac
ttcaagttgggcaccatcaagggccaattcaacttcgtccacgtgattatcacgcccctg
gactacgagtgcaacctggtgtctctgcagtgcaggaaagacatggagggccttgtggat
accagcatggccaagatcgtgtctgaccgaaacctgcccttcgtggcccgccagatggcc
ctgcacgccaatatggcctcgcaggtgcaccatagccgctccaatcccaccgacatttat
ccctccaagtggattgccaggctccgccacatcaagcggctgcgccagcggatccgtgag
gaagcccactactcaagcgccagcctgcccctgatgcagacacaccctcctggtcatgcc
aaggctccggcacaggccccggccgagtccacgcccacctatgagacgggccagcggaaa
cgcctggtctcctctgtggacgacttcactgagttcgtgtga

DBGET integrated database retrieval system