KEGG   Bos indicus (zebu cattle): 109578386
Entry
109578386         CDS       T04792                                 

Gene name
MAD1L1
Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD1 isoform X1
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04110  Cell cycle
biu04114  Oocyte meiosis
biu04914  Progesterone-mediated oocyte maturation
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109578386 (MAD1L1)
   04114 Oocyte meiosis
    109578386 (MAD1L1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109578386 (MAD1L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109578386 (MAD1L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109578386 (MAD1L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:biu03036]
    109578386 (MAD1L1)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     109578386 (MAD1L1)
SSDB
Motif
Pfam: MAD TSC22
Other DBs
NCBI-GeneID: 109578386
NCBI-ProteinID: XP_019843071
UniProt: A0A6P5DXI9
LinkDB
Position
25
AA seq 717 aa
MEDLGENTTVLSTLRSLNNFISQRVEGGSGLDVSTSAQGSLQTQYQQSMQLEERAEQIRS
KSHLIQVEREKMQMELSHKRARVELERAASTSARNYEREVDRNQELLTRIRQLQEREAEA
QEKMKEQLERHRLCQQSLDAAGRKLREKEDGLAEAGETITTLKGRLSDLQWSMMNQEMQV
KRLESEKQELKEQLDLQHQKWQEANQKVQELQASQEVRADQEQRIKDLEQKLSLQEQDAA
IVKNMRSELVRLPTMERELRQLREENACLRETQDTNGLLREELEGLQRRLGRQEKMQETL
VDLELEKERLLTKLQSWERLDQTTGLSIRTPEDLSRFIVELQQRELALKDXNSAITSSAR
ELEKARLQLQDEVRQLGGQLLEERKRRETHEALARRLQKRVLLLTKERDGMRAILGSYDS
ELTPAEHSPQLTRRMREAEDMMQKVQAHSSEVEAQLSQALEELGGQKQRADMLEMELKIL
KSQAGPAEQSFLFSREEVSSLRLKVEELEAERSRLEEEKKTLEAQLERLTLQGDYDQSKT
KVLHLSQNPAGAARQRLREDQQQLQEECARLRELVRALEAGGPVPAHLEAGAGLPSSREV
AELKKQVESAELKNQRLKEVFQTKIQEFRKVCYTLTGYQVDITTESQYRLTSMYAEQKAD
CLIFKAAGPSGTKMQLLETAFSRTVPGLIELHLLQQDSIPAFLSALTLDLFSRQTLA
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggaagacctgggggagaacaccaccgtcctgtccaccctgaggtctttgaacaacttc
atttctcagcgagtggagggaggatctggactggatgtttccacctctgctcaaggttct
ctgcagacgcagtaccagcagagcatgcagttggaggagcgagcagagcagatccggtct
aagtctcacctcatccaggtggagcgggagaagatgcagatggagctgagtcacaagagg
gctcgtgtggagctggagcgggcggccagcaccagcgccaggaactacgagcgcgaggtg
gaccgcaaccaggagctcctgacgcgcattcggcagcttcaggagcgggaggcggaggcg
caggagaagatgaaggagcagctggagcggcacaggctgtgccagcagagcctggacgcg
gccggcaggaagctgcgggagaaggaggacggcctggccgaggccggggagaccatcacc
acgttgaaggggaggctctcggacctgcagtggagcatgatgaaccaggagatgcaggtc
aaacgcctggagtctgagaagcaggagctgaaggagcagctggacctgcagcaccagaaa
tggcaggaagctaaccagaaggttcaggagctccaggccagccaagaagtgcgagcagac
caggagcagaggatcaaggatttggagcaaaagctgtccctgcaggagcaggacgctgcg
attgtgaagaacatgaggtctgagctggtgcggctgccaacgatggagagggagctgcgg
cagctgcgggaagagaacgcctgcctgcgggagacgcaggacaccaacgggctgctgcgg
gaggagctggaggggctgcagcgcaggctggggcggcaggagaagatgcaggagacgctg
gtggacctcgagctggagaaggagaggctcttgacaaagctgcagagctgggagaggctg
gaccagaccaccggcttgagcatcaggacgccagaggacctgtctaggttcattgtggag
ctgcagcagcgcgagctggccctgaaggacargaacagtgccatcaccagcagtgcccgg
gagctggagaaggcccgactgcagctccaggacgaggtccgccagctcggtggccagctg
ctggaggagaggaagcggcgcgagacgcacgaggccctggcgcggcggctgcagaagaga
gtcctgctgctgacgaaggagcgcgacggcatgcgggccatcctgggctcgtacgacagc
gagctgaccccagctgagcactcgccccagctgacccgccgcatgcgcgaggccgaggac
atgatgcagaaggtgcaggcgcacagctcggaggtggaggctcagctgtcacaggcgctg
gaggagctgggaggccagaagcaaagagccgacatgctggagatggarctgaagatactg
aagtcacaggcgggcccggctgagcagagcttcctattctccagggaggaggtgagctca
ctcaggttgaaggttgaggagctggaagccgagcggagtcgcctagaggaggagaagaag
acgctggaggcgcagctggagcggctcacactgcagggcgactacgaccagagcaagacc
aaggtgctgcacctgagccagaacccggccggcgcggcgcggcagcggctccgcgaggac
cagcagcagctgcaggaggagtgtgcgcggctgcgggagctcgtccgcgccctggaggcc
ggcggccctgtccccgcccacctggaggccggcgcagggctgccctcgtcccgggaggtg
gcagagctgaagaagcaggtggagagtgcagagctgaagaaccagcggctgaaggaggtc
ttccagaccaagatccaggagttccggaaagtgtgctacacgctgacgggctaccaggtg
gacatcaccacagagagccagtaccggctgacctccatgtacgccgagcagaaggccgac
tgcctcatcttcaaggccgcgggcccctcgggcaccaagatgcagctgctggagacggcg
ttctcgcggacggtgccagggctcatcgagctgcatctgctgcagcaggacagcatccct
gccttcctcagcgccctgaccctcgacctcttcagccgccagacgctggcctag

DBGET integrated database retrieval system