KEGG   Bos indicus (zebu cattle): 109578518
Entry
109578518         CDS       T04792                                 

Gene name
AXIN1
Definition
(RefSeq) axin-1 isoform X1
  KO
K02157  axin 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04310  Wnt signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04934  Cushing syndrome
biu05010  Alzheimer disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05213  Endometrial cancer
biu05217  Basal cell carcinoma
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109578518 (AXIN1)
   04390 Hippo signaling pathway
    109578518 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109578518 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109578518 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109578518 (AXIN1)
   05225 Hepatocellular carcinoma
    109578518 (AXIN1)
   05226 Gastric cancer
    109578518 (AXIN1)
   05217 Basal cell carcinoma
    109578518 (AXIN1)
   05213 Endometrial cancer
    109578518 (AXIN1)
   05224 Breast cancer
    109578518 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109578518 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    109578518 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109578518 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109578518 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109578518 (AXIN1)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109578518 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 109578518
NCBI-ProteinID: XP_019843358
UniProt: A0A6P5DYG0
LinkDB
Position
25
AA seq 831 aa
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPVSHSFCSGKGAGIKGETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDFWFA
CSGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKDCISKQQIDPA
MFDQAQTEVQSTMEENTYPSFLKSDIYLEYTRTGSESPKLCSDQSSGSGTGKGVPGYLPT
LNEDEEWKCDREVDEDSGRDPAPPGRLTQKLLLETAAPRASSSRRYSEGRELRCGSWREP
VNPYYVNSGYALAPATSANDSEQQSLSSDADSLSLTDSSVDGVPPYRTRRQHRREMQESV
QANGRVPLPHIPRTYRMPKEVRVEPQKFAAELIHRLEAVQRTREAEEELEERLKRVRMQE
EEGEDSDMPSGPQGASHKLPSAPAWHHFPSRYADVGCTGLRDAHEENPESILDEHVQRVM
RTPGCQSPGPGHRSPDSAHVPKIGVLGGAMPGHGKHAPKLGAKLDPTGLHLHRHGHHHGH
HGAARPKEPAEAEAARRVPGSFAWGPELHGHAAKPRSHVESTGAPPAGGDGLAYGGKVGT
TSKRNSKKAELGKSSSTEAPGPSEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGAKKQQ
AHESSRPLSIERPGAVHPWVSAQLRSSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLE
EEEKRASKAPSKQRTKSQRKAGGGSTQPCDSIVVAYYFCGEPIPYRTLVRGRAXTLGQFK
ELLTKKGNYRFYFKKVSDEFECGVVFEEVREDTAVLPVFEEKIIGKVEKVD
NT seq 2496 nt   +upstreamnt  +downstreamnt
atgaatatccaggagcagggtttccccttggacctcggagcaagtttcaccgaagatgcc
ccccgacccccagtgcctggtgaggagggtgaactggtgtccacagaccccaggcccgtc
agccacagcttctgctctgggaaaggcgctgggattaaaggggagacttccacagccact
ccgaggcgctcggacctggacctggggtacgagcctgagggcagcgcgtcgcccacccct
ccgtacttgaagtgggccgagtcgctgcactccctgctggacgatcaagacggcataaac
ctgtttaggactttcctgaaacaggaggactgtgccgacctcctggacttctggtttgcc
tgcagcggcttcagaaaactggagccctgtgactcgaatgaagagaagaggctgaagctg
gccagagccatctaccgcaaatacatccttgataacaacggcattgtgtcccggcagacc
aagcccgccaccaagagcttcataaaggactgcatctcgaagcagcagatcgaccccgcc
atgttcgaccaggcacagacggaggtccagtccaccatggaggagaacacctacccctcc
ttcctcaagtccgacatttacctggagtacacgaggacaggctcggagagcccgaagctc
tgcagtgaccagagctctgggtcagggacagggaagggtgtccccgggtacctgcccacg
ctgaacgaagacgaggaatggaagtgtgaccgggaggtggatgaagacagtggccgggac
cctgctccgcccggcaggctcacgcagaagctgctcctggagacggccgccccgagggcc
tcctcgagtagacggtacagcgaaggaagagagctcaggtgtggatcgtggcgggagccc
gtcaacccctactacgtcaactctggctacgccctcgcccccgccaccagcgccaatgac
agcgagcagcagagcctgtccagcgacgctgacagcctgtccctcaccgacagcagcgtg
gatggagtcccgccctacaggacccgcaggcagcaccgccgggagatgcaggagagcgtc
caggccaacgggcgggtgcctctacctcacattcctcgcacataccgaatgccaaaggaa
gtccgcgtggagccccagaagttcgcggcagagctcatccaccgcctggaggccgtgcag
cggacgcgggaggccgaggaggagctggaggagcggctgaagcgtgtccgcatgcaggag
gaggaaggcgaggacagcgacatgccctctggcccccagggcgccagccataagctgccc
tcggccccggcctggcaccacttcccctcccgctacgcggacgtgggctgcacagggctg
cgggacgcgcacgaggagaaccccgagagcatcctggacgagcacgtgcagcgagtcatg
aggacgcctggctgccagtcgccggggcccggtcaccgctccccagacagcgcgcacgtg
cccaagattggggtgctggggggtgccatgcccgggcatggaaaacatgcgcccaagttg
ggggcaaagctggacccgactgggctgcacctccacagacacggccaccaccacggccac
cacggcgcggcccggcccaaggagccagctgaggctgaggccgcccgccgggtcccgggc
agcttcgcctggggcccggagctgcacggtcacgcagccaagccccgcagccatgtggag
agcacgggcgccccccctgccggtggcgacggcctggcctacggtgggaaggtgggcacg
acctccaagagaaactccaagaaggcggagttggggaagagcagcagcacagaggcgcca
ggcccrtctgaggatgcggagaagaaccagaagatcatgcagtggatcatcgagggcgag
aaggagatcagccggcaccggaaggcgggtcacgggtcgtccggggctaagaagcagcag
gcccacgagagctccaggcccctgtccattgagcgccctggggccgtgcacccctgggtc
agtgcccagctccggagttcggtgcagccttcgcatctcttcattcaagaccccacgatg
ccacccaaccctgcccccaaccccctgacgcagctggaggaggcacgccggcgcctggag
gaggaggagaagagggccagcaaggcgccctcgaagcagaggacgaaatcacagaggaag
gcgggaggtgggagtacccagccatgcgacagcatcgtcgtggcctactacttctgcgga
gagcccatcccctaccggaccctggtgcggggccgcgcgrtcaccctgggccagttcaag
gagctgctgaccaagaagggcaactacaggttctacttcaagaaagtgagcgacgagttc
gagtgcggcgtggtgttcgaagaggtgcgtgaggacacggctgtgctgcccgtcttcgag
gagaagatcatcggcaaggtggagaaggtggactga

DBGET integrated database retrieval system