KEGG   Bos indicus (zebu cattle): 109578521
Entry
109578521         CDS       T04792                                 

Gene name
IL4R
Definition
(RefSeq) interleukin-4 receptor subunit alpha isoform X1
  KO
K05071  interleukin 4 receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu05200  Pathways in cancer
biu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109578521 (IL4R)
   04151 PI3K-Akt signaling pathway
    109578521 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109578521 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109578521 (IL4R)
   04658 Th1 and Th2 cell differentiation
    109578521 (IL4R)
   04659 Th17 cell differentiation
    109578521 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109578521 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109578521 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109578521 (IL4R)
   04090 CD molecules [BR:biu04090]
    109578521 (IL4R)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL2 receptor family
   109578521 (IL4R)
CD molecules [BR:biu04090]
 Proteins
  109578521 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N EpoR_lig-bind
Other DBs
NCBI-GeneID: 109578521
NCBI-ProteinID: XP_019843369
UniProt: A0A6P5DZB2
LinkDB
Position
25
AA seq 844 aa
MGRLLSVLMFPVSCLILLWVAGSGSMRVLQDPTCFSDYISNSTCEWEMAGPTNCRAELHL
SYQLNFYYSENHTCVPENRAGVGGTVCICHMLTENPVRQDXYQLDLWAGKQLLWNSSFKP
SEHVKPPAPRNLTVHADISHTWLLTWNNPYPSDNLLYSELTYLVNISNENDPTDVQVGGG
HCQPLTFSPQILTLEGQHLNARGPGAPWSQFRTYNVTYMGPTLRVAASTLRSGASYSARV
KAWAQSYNSSWSXWSPSTXWLNYYEDTWEQRLQLGVGISCVIVLAVCVSCYISIIKIKKE
WWDQIPNPAHSPLVAVVIQDSQVSLWRKRSRGQEPAKCPHWKTCLAKLLPCLLEHGMERD
DDFSKAARNGPSQGSGKVAWCPVEVSKTILRPESISVVRCVELFEAQVEKEEEEVEEDKG
SFCPSPENSGGLFQEGREDIAARLTESLFLHLLRDXTGGFSPQGVESCLLPPLENANAQR
PWAEFPRVEXQEASSEDKEQPLSPESSPPXTPTQNPAGLPLPEMPTIISDNPAYRSFSTF
LSQSSGPGELDSDPQLAECLGEVDPNIPTTPKPEPETWEQILRQRVLQHRAAPGPASAPS
SGYREFVQAVKEGGTQDSGPAGFGPSEEAGYKAFSSLLASSDSCPATSGVDPSSGEGGYK
PFQSLASGCPRTPSPTPVPLFTFGLDMDPPHSPQDSEWPELEPAVKGDDGQKPLFAPVPV
TDPLRDDLGNGIIYSALTCHLCGHLKQCHGQEEAGKAQIVVSPCCGCCCGDRSSPLLSPL
KAPDSLPQGTPLAASLSAASLAPLGVSEEGKCPLFNAPSHAQSSGQAPAVTAVPSPGPTC
MDAS
NT seq 2535 nt   +upstreamnt  +downstreamnt
atggggcggcttctctctgtactcatgttcccagtgagctgcctgatcctgttatgggtg
gccggctctgggagcatgagggtccttcaggatcccacctgcttctcggactacatcagc
aactccacctgtgagtgggagatggccggacccaccaactgcagagccgagctccacctg
tcctaccagctgaatttttactactctgaaaaccacacatgtgtccccgagaacagagca
ggtgtggggggcacagtgtgcatatgccatatgctgacagagaacccagtcagacaagac
atstaccagctggacctgtgggcagggaagcagctactgtggaacagctccttcaagccc
agcgagcacgtgaaaccaccggcccccagaaacctcacggttcacgccgacatctcccac
acgtggctgctgacgtggaacaacccgtacccttctgataacctcctgtactccgagctc
acctacctggtcaacatctcaaatgaaaatgaccccacggatgtgcaggtgggtggaggc
cattgtcagccactcacgttctcgcctcagatactcacattggagggacaacatctgaac
gccagaggccctggcgccccgtggagccagttcagaacctataacgtgacctacatgggg
cccaccctgcgtgtcgcggccagcaccctgaggtctggagcttcctacagcgcacgggtg
aaggcctgggctcagagctacaacagcagctggagckcgtggagccccagcaccamgtgg
cttaactactacgaggacacctgggagcagcgcctccagctgggcgtcggcatctcgtgc
gtcatcgtcctggcggtgtgcgtgtcctgctacatcagcatcatcaagattaagaaagaa
tggtgggaccaaattcccaacccagcccacagccccctygtggctgttgtcatccaggat
tctcaggtgtcactgtggaggaagcggtctcgaggccaggaaccagccaaatgcccacac
tggaagacttgtcttgccaagctcctgccctgtttactggagcatggcatggagagggat
gacgacttctctaaggctgctagaaatgggccttcccagggttctgggaaagtagcatgg
tgccccgtggaggtcagcaagacgatcctccggcctgagagcatcagcgtggtgcggtgc
gtggagctgtttgaggcccaagtggagaaggaagaagargaagtggaggaagataaaggg
agcttctgcccatcacctgagaacagcgggggcctcttccaggagggcagagaggacatt
gcggcccggctgacagagagcctgttcctgcaccttctcagagatgasactgggggcttt
agtccacaaggtgtggagtcctgccttcttccccctttagaaaatgcaaatgctcagagg
ccctgggccgaattcccaagggtggarycccaggaggcatcatctgaggacaaggaacag
cctctgagcccagagtcaagtcctccggscactccaacccagaacccagccggcctgcct
ctcccagagatgcccaccatcatctcagacaaccctgcttaccgcagcttcagcaccttc
ctgagccagtcctcgggccctggagagcttgactcagacccacagctggccgaatgcctg
ggggaagtggaccccaacatccccaccacccccaagccggaaccagagacctgggaacag
attctgcgtcagagggtgctccagcacagggcggcccccggccccgcctcggcccctagc
agcggctaccgggaatttgtgcaggcggtgaaggagggtggcacccaggacagcgggccg
gctggcttygggccctctgaagaggccggctacaaggccttctccagcttgcttgccagc
agtgacagctgccctgcgacttctggggttgaccccagcagcggggaagggggctacaaa
cccttccagagccttgcttctggctgccccaggaccccttcccccactcccgttcccctg
ttcactttcggcctggacatggacccccctcacagtcctcaggactcagagtggcctgag
ttggagccagcagtcaagggagacgatggacagaaacccctcttcgcccccgtgccggtc
acagaccctctcagggacgacctgggcaacggcatcatctactcagccctcacctgccac
ctatgtggccacctgaagcagtgccacggccaggaggaagctggcaaggcgcaaattgtg
gtcagcccctgctgcggctgctgctgtggggacaggtcctcgcctctgctgagtccgctg
aaagccccagactccctgccccaggggactccactggcagccagcctctctgcggcctcc
ctagcacccttaggtgtctcagaggagggtaagtgccctctgttcaatgcccccagccat
gcccagagctcaggccaggctcctgcagtgactgccgtgccctccccaggccccacgtgc
atggacgcttcctag

DBGET integrated database retrieval system