KEGG   Bos indicus (zebu cattle): 109578719
Entry
109578719         CDS       T04792                                 

Gene name
CTF1
Definition
(RefSeq) cardiotrophin-1
  KO
K05422  cardiotrophin 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109578719 (CTF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109578719 (CTF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109578719 (CTF1)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109578719 (CTF1)
SSDB
Other DBs
NCBI-GeneID: 109578719
NCBI-ProteinID: XP_019843741
UniProt: A0A6P5DZL9
LinkDB
Position
25
AA seq 202 aa
MSRREGSLEDPQADSSASPLPHLEAKIQQTHSLARLLTKYAEQLLQEYVQHQGDPFGLPG
FSPPRLPVADLSDPAPGHAGLPVPERLRLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDAAVAASTASAGVFPAKVLGFRVCG
LYLEWVSRTEADLGQLAPGGPA
NT seq 609 nt   +upstreamnt  +downstreamnt
atgagccggagggagggcagtctggaggacccccaggctgactcctcagcctcacccctt
ccccacttggaggccaagatccaacagacacacagccttgcccgcctcctcaccaaatat
gctgagcagcttctccaggaatatgtgcagcaccagggagaccccttcgggctgcccggc
ttctcgcccccgcggctgccggtggccgatctgagcgacccggccccgggccacgctggc
ctgccagtgcccgagcgcctgcggctggacgnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnggacgccgcagtcgcc
gcctccactgcctcagcgggcgtcttcccggccaaggtgctggggttccgtgtgtgcggc
ctctacctcgagtgggtgagccgcactgaggccgacctgggccagctggcgcccgggggc
ccggcctga

DBGET integrated database retrieval system