KEGG   Bos indicus (zebu cattle): 109578805Help
Entry
109578805         CDS       T04792                                 

Gene name
WBSCR17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00512  Mucin type O-glycan biosynthesis
biu01100  Metabolic pathways
Module
biu_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    109578805 (WBSCR17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:biu01003]
    109578805 (WBSCR17)
Enzymes [BR:biu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     109578805 (WBSCR17)
Glycosyltransferases [BR:biu01003]
 O-Glycan biosynthesis
  Mucin-type
   109578805 (WBSCR17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 109578805
NCBI-ProteinID: XP_019843875
LinkDB All DBs
Position
25
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPISVRSGDSFHEIRPRAEAANISAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDTFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPMENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNAKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNRGTGRCLEVENRGLAGIDLTLRSCTGQRWTIKNSIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctcttggtgttgaacttgatcgcggtggccggc
ttcgtgctcttcttggccaagtgccggcccatctcggtgcgcagcggagactccttccat
gagattcggccgcgggccgaggccgctaacatcagcgcgcacagcgccagccccatccag
gatgcggtcctgaagcgcctctcgctgctcgaggacattgtctaccggcaactaaacggt
ttatccaaatcccttgggctcattgaaggttatggtgggcggggcaaaggaggccttcct
gccaccctttcccctgctgaagaagagaaagccaagggaccccatgagaaatatggctac
aattcctacctcagtgaaaaaatttcactggatcgttccattccggattatcgtcccacc
aagtgtaaggagctgaagtactccaaggagctgccccagatatccatcatatttatcttc
gtgaacgaggccctgtcggtgatcctgcgctcagttcacagcgcggtcaaccacacgccg
acccacctgctgaaggagatcatcctggtggatgacaacagtgacgaagaggagctgaag
gcccccttggaggagtatgtccacaaacgctaccccgggctggtgaaggtggtgagaaac
cagaagagagagggactgatccgagctcgtattgagggctggaaggtggccaccggccag
gtcactggcttctttgatgcccacgtggagttcaccgctggctgggccgaaccagtgctc
tcgcggatccaggagaaccggaagcgtgtgatccttccctccatcgacaacatcaagcag
gacaccttcgaggtgcagcggtatgagaactcggcccacgggtacagctgggagctatgg
tgcatgtacatcagccccccgaaagactggtgggacgccggagacccttccctccccatc
aggacaccagccatgatcggctgctcgtttgtggtcaacaggaagttctttggtgaaatc
ggtcttctggaccctgggatggatgtgtatggaggagaaaatatcgaacttggaatcaag
gtgtggctgtgtgggggcagcatggaggtcctgccttgctcacgggtggcccacatcgag
cggaagaagaaaccrtacaacagcaacatcggcttctacaccaagaggaacgctctacgg
gttgctgaagtctggatggacgactacaagtctcatgtgtacatagcgtggaatctgccr
ctagagaatccaggaattgacattggcgatgtctctgaaagaagagccttaaggaaaagt
ttaaagtgtaagaatttccagtggtatctggaccacgtctacccagaaatgcgaagatac
aataacaccgtcgcctacggggagcttcgcaacaacaaggcaaaagacgtctgcttggac
caggggccaatggagaaccacacrgcaatactgtacccgtgccacggctggggaccccag
ctggctcgctacaccaaggagggcttcctgcacttgggcgccctggggaccaccacgctc
ctccctgacacccgctgcctggtggacaacgccaagagtcggctgccccagctcctggac
tgcgacaaggtcaagagcagcctgtacaagcgctggaacttcatccagaacggcgccatc
atgaacagaggcacrggacgctgcctggaggtggagaaccgaggcctggcgggcattgac
ctcacgctccgcagctgcacggggcagaggtggacgatcaagaactccatcaagtag

DBGET integrated database retrieval system