KEGG   Bos indicus (zebu cattle): 109578826
Entry
109578826         CDS       T04792                                 

Definition
(RefSeq) interleukin-9 receptor-like
  KO
K05073  interleukin 9 receptor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109578826
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109578826
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109578826
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109578826
   04090 CD molecules [BR:biu04090]
    109578826
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL2 receptor family
   109578826
CD molecules [BR:biu04090]
 Proteins
  109578826
SSDB
Other DBs
NCBI-GeneID: 109578826
NCBI-ProteinID: XP_019843900
UniProt: A0A6P5E381
LinkDB
Position
25
AA seq 472 aa
MGTERGRVWAAGAHLLQTGWGFSPTQGAWSQPIPLGCPAPPWSPQGSFSQACPVTGGQRQ
ALPLPWPCPKAATVNLPRSLFPGPGPGAFTCYNNNILRIECRWPGPALGQGAGSWLLFTS
NVVPGSKHKCVFWAGVCTVELPPEEVLVPADNFTITFHHHISGKEQVSLVDPQYLPRRHV
KLDPPSDLQSNVSSEHCVLTXSVSPALEPLAMLLSYELAFKRQEEAWEWARHKDHIVGVT
WLKLEAAELDPGSAYEARLRVQMAALEGEVAEEERYEGVWSDWSQPACFAAPPRRGRLVP
ALGQSDSTLVAVSLFLLLSSLIYLLFKLSPRMKTALYKDVPSPGPFFQPLYSVHNGDFQT
WIGARGASPQAGRDHAGPPRGALLEARVREAVALLHCDPADAWPSVGLEEEGGPGPGLPA
GVLPAGHVEWGVPSPAYLPQEDWAPAGRPRLAPPRCEGSSGDYCALDCSVGS
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgggcacagagcggggcagggtctgggctgcgggtgcccatcttctgcagaccggttgg
ggcttcagccccacccagggcgcatggtcacagcccatccccttagggtgcccagccccg
ccgtggtcacctcagggctccttctctcaggcctgccctgtcacagggggtcagcgccaa
gccctccccctcccctggccctgccccaaggcagccacggtgaacttgccacggtcactg
ttcccagggccagggcctggggctttcacctgctacaataacaacatcctcaggattgag
tgccgctggcctggcccagcgctgggccagggggccggctcctggctgctcttcaccagc
aacgtcgtgccgggcagcaagcacaagtgtgtcttctgggccggcgtgtgcaccgtggag
ctgccgcccgaggaggtcctcgtgcctgctgacaacttcaccatcaccttccaccaccac
atctccgggaaggagcaggtcagccttgtggatccacagtatctgccccggagacacgtg
aagctggaccccccctcggacttgcagagcaacgtcagctctgagcactgtgtcctgacc
tkgagcgtcagtcctgccttggagccgctggccatgctcctcagctatgaactggccttc
aagaggcaggaggaagcctgggagtgggctcggcacaaggatcacatcgttggggtgacc
tggctcaaacttgaagccgccgagttggaccctggttctgcctatgaggcccggctgcga
gtccagatggctgccctagagggcgaggtggcggaggaggagcgatacgagggcgtgtgg
agtgactggagccagcctgcctgctttgccgctccccccagacgaggtcgcctggtccct
gctctggggcagtctgatagcaccctggtcgctgtgtccctcttcctcctgctgagcagc
ctgatctacttactgttcaaactgtcgcccaggatgaagacagctttgtacaaggatgtg
ccgtccccaggcccattcttccagcctctgtacagcgtgcacaacggggacttccagacc
tggataggggcccgcggagccagcccacaggctggccgggaccatgccggcccmccacga
ggagccctcctggaagcccgtgtccgggaggccgtcgctttgctgcactgtgacccagca
gacgcctggccgtcggtgggcctggaggaggagggcggccctgggcccggcctcccrgca
ggtgtgctgccagcaggacacgtggagtggggggtgccgtcgcccgcctacctgccacag
gaggactgggcccctgcgggccgcccccggctggcgcccccccggtgcgagggcagcagt
ggcgactactgtgccctggactgctctgtggggagctga

DBGET integrated database retrieval system