KEGG   Bos indicus (zebu cattle): 109579160
Entry
109579160         CDS       T04792                                 

Gene name
SUFU
Definition
(RefSeq) suppressor of fused homolog isoform X1
  KO
K06229  suppressor of fused
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04340  Hedgehog signaling pathway
biu05200  Pathways in cancer
biu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    109579160 (SUFU)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109579160 (SUFU)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    109579160 (SUFU)
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 109579160
NCBI-ProteinID: XP_019844247
UniProt: A0A6P5E4H0
LinkDB
Position
26
AA seq 495 aa
MAELRPSGAPGPTATPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKY
WLGGPDPLDYVSMYRNVGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFEL
TFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLT
EDPQMQPVQTPFGVVTFLQIVGVCTEELHAAQQWNGQGILELLRTVPVAGGPWLITDMRR
GETIFEIDPHLQQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICVGAQPRR
LSGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLTHDRAPSRKDSLESDSSTAIIPHE
LIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFAT
EEHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEVSCLVLSDSRFQSPGVCLRVCMCL
SLTCAERLERRPWRC
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggcggagttgcggcctagcggcgcccccggccccaccgcaaccccggcccctggccct
actgcccctccggccttcgcytcgctcttccccccaggactgcacgccatctacggagag
tgccgccgcctgtacccagaccagccgaacccgctccaggttaccgctatcgtcaagtac
tggttgggtggcccagaccccttggattatgttagcatgtacaggaatgtggggagcccc
tctgccaacatccctgagcactggcactacatcagctttggcctgagcgatctctatggc
gacaacagagtccatgaattcacaggaacagatggacctagtggttttggctttgagttg
acatttcgtctgaagagagaaacaggggagtctgcgcccccaacatggccagcagagcta
atgcagggcttggccagatatgtgttccagtcagagaacaccttctgcagtggcgaccac
gtgtcttggcacagtcctttggacaacagtgagtcaagaattcagcacatgctgctgaca
gaggacccgcagatgcagcctgtgcagacaccctttggggtggtcaccttcctccagatc
gtcggtgtctgcactgaggagctccacgcagcccagcagtggaatgggcagggcatcctg
gagctgctgcggacagtacccgtcgctggcggtccctggctgataactgacatgcggagg
ggagagaccatatttgagatcgatccgcacttgcaacaggagcgagttgacaaaggcatc
gagacagacggctccaacctgagtggtgtcagtgccaagtgcgcctgggatgacctgagc
cggccccccgaggatgacgaggacagccggagcatctgcgtgggcgctcagccccggcgg
ctctccggcaaagacacagagcagatccgggagaccttgaggagaggacttgagatcaac
agcaaacccgtccttccgccaatcaaccctcagcgacagaacggcctcacccacgaccgg
gccccgagccgcaaagacagcctggaaagcgacagctccacggccatcattccccacgag
ctgatccgtacgcggcagctggagagcgtccatctgaaattcaaccaggagtcaggagcc
ctcatccctctctgcctcaggggcaggctcctgcacggacggcactttacatataaaagy
atcacaggtgacatggccatcacctttgtctccacgggagtagaaggcgcctttgccacc
gaggagcacccttacgcagctcacggaccctggttacaaattctgttgaccgaagagttt
gtagagaaaatgttggargacttagaagatttgacttctccagaggaagtaagctgtttg
gttctctctgacagcaggttccagtctccaggagtctgtctgcgtgtgtgcatgtgtctg
tctctgacgtgtgcagagaggctggaaaggagaccctggagatgttaa

DBGET integrated database retrieval system