KEGG   Bradyrhizobium diazoefficiens USDA 110: bll0188Help
Entry
bll0188           CDS       T00109                                 

Definition
(RefSeq) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01130  Biosynthesis of antibiotics
bja01230  Biosynthesis of amino acids
Module
bja_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bll0188
Enzymes [BR:bja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     bll0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 AAA_17 ETF AAA_16 CoaE AAA_22 RsgA_GTPase AAA_5 Mg_chelatase AAA MMR_HSR1 TsaE
Motif
Other DBs
NCBI-GeneID: 1052502
NCBI-ProteinID: NP_766828
RhizoBase: bll0188
UniProt: Q89XW7
LinkDB All DBs
Position
complement(183178..183912)
Genome map
AA seq 244 aa AA seqDB search
MARVLWRGPLWGRIGGQSRPLLAADRARPRARSRARPMSDAALPIQASPEADILSALGAR
SIVLVGMMGVGKSTIGRRMAARLKLPFVDADTEIEAAAGMTIPEIFERHGEGHFRDGEAR
VIARLLDGGPVVLATGGGAFMREETRARIAAKAVSIWLKADHDVIMRRVRRRADRPLLQT
ADPEGTVTRLLTEREPVYSHADLTIASRDVPHDKIVEECIETLRAHLCGEQAAQPPADVA
SAVR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtggcaagagtcctctggcgaggccccctttggggtcgtataggtggccaaagcaggccg
cttttggcggcagatcgagcgagacccagagcgagatccagagcgagacccatgtccgac
gccgcgttgccgatacaagcatcgcctgaggccgacatcctgtcggcgctcggggcgcgc
tcgatcgtgctcgtcggcatgatgggggtgggtaaatccaccatcggccgccgcatggcg
gcccggctcaagctgcccttcgtcgacgcggacaccgagatcgaggcggcggccggcatg
accataccggagattttcgagcgccatggcgagggccatttccgcgacggcgaggcccgc
gtgatcgcgcgcctgctcgacggcggcccggtggtgctggcgaccggcggcggcgccttc
atgcgcgaggagacgcgtgcgcgcatcgcggccaaggcggtctcgatctggctcaaggcc
gaccacgacgtcatcatgcgccgcgtccgccgccgcgccgaccgcccgttgctccagacc
gccgaccccgagggaaccgtgacgcgcctgctcaccgagcgcgagccggtctacagccat
gccgacctcaccatcgcctcgcgcgacgtgccgcacgacaagatcgtcgaggagtgtatc
gagacgctgcgcgcccatctctgcggcgaacaggccgcccaaccacctgccgacgttgcg
agtgccgtacgatga

DBGET integrated database retrieval system