KEGG   Bradyrhizobium diazoefficiens USDA 110: bll0902Help
Entry
bll0902           CDS       T00109                                 

Definition
(RefSeq) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00500  Starch and sucrose metabolism
bja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    bll0902
Enzymes [BR:bja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     bll0902
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     bll0902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 1049834
NCBI-ProteinID: NP_767542
RhizoBase: bll0902
UniProt: Q89VZ1
LinkDB All DBs
Position
complement(982050..983747)
Genome map
AA seq 565 aa AA seqDB search
MIDDLWYKNGVIYCLSVGTYMDADGDGVGDFKGLLRRLDYLHGLGITTIWLMPFQTSPGR
DDGYDIADYYSVDSRYGTLGDFVEFAHGCKQRGIRIIIDLVVNHTSDQHRWFKDARRDKN
SPYRDWYVWSDTKPANANKGMVFPGVQKSTWTRDKDAGAWYFHRFYDFQPDLNTSNPHVQ
AEILKIMGFWIQLGVSGFRMDAVPFVIATKGAKVKKPVEQYDMLRAFREFLQWRQGDAII
LAEANVLPETDMEYFGRDADRMHMMFNFHVNQHLFYALASADSRPLAKALKATKPRPGSA
QWGLFLRNHDELDLGRLTPAQRDTVFKSFGPDKDMQLYDRGIRRRLAPMLGGDRRRLELA
YSLMCTLPGTPVIRYGDEIGMGDDLSLPERNCARTPMQWSTEPHGGFTKNDKPACPVIDK
GPYGFPHVNVAKQRRDANSMLNWTERIVRMRKEVPEIGWGDFAVIATRDPAVFIMRYDWR
NNSVLFVHNLDEKPREIAFSTGLPDDAGAHLINLLAEDHSHADKRGQHRVVLEPYGYRWY
RVGGLDYLLKRSDIDGDTAGNKHPG
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgatctctggtacaagaacggcgtgatctactgcctgtccgtcggcacctat
atggatgccgacggcgacggcgtcggcgacttcaagggcctgctgcggcggctcgactat
ctgcacggcctcggcatcaccacgatctggctgatgccattccagacctcgcccggccgc
gacgacggctacgacatcgccgactattacagcgtcgattcccgctacggcacgctcggc
gacttcgtcgaattcgcccatggctgcaagcagcgcggcatccgcatcatcatcgacctc
gtcgtcaaccacacctcggaccagcatcgctggttcaaggacgcgcggcgcgacaagaac
tcgccctatcgcgactggtacgtctggtccgacacgaagcccgccaatgccaacaagggc
atggtgtttcccggcgtgcagaaatcgacctggacgcgcgacaaggacgccggcgcctgg
tattttcatcgcttctacgattttcagcccgacctcaacacctcgaacccgcacgtgcag
gccgagatcttgaagatcatgggcttctggatccagctcggcgtctccggattccgcatg
gacgccgtgcccttcgtgatcgcgaccaagggcgccaaggtgaagaagccggtcgagcaa
tacgacatgctgcgcgcgttccgcgaattcctgcaatggcgccagggtgacgccatcatc
ctcgccgaagccaatgtgctgccggaaaccgacatggaatatttcggccgcgatgccgac
cgcatgcacatgatgttcaacttccacgtcaaccagcatctgttctatgcgctggcgtcg
gccgactcgcgaccgctggcaaaggcgctgaaggcgaccaagccgcggccgggctcggcg
caatggggcctgttcctgcgcaatcacgacgagctcgatctcgggcgcttgaccccggcg
cagcgcgacaccgtgttcaagagcttcggccccgacaaggacatgcagctctacgaccgc
ggcattcgccgccgcctcgcgccgatgctcggcggcgaccgcaggcggctcgagcttgcc
tacagcctgatgtgcacgctgccgggaacgcccgtgatccgctatggcgacgagatcggg
atgggcgacgatctctcattgccggagcgcaattgcgcgcgcacgccgatgcaatggtcg
accgagccgcatggcggcttcaccaagaacgacaagccggcctgtcccgtcatcgacaag
ggcccttatggctttccgcacgtcaacgtcgccaagcagcggcgcgatgccaattccatg
ctgaactggaccgaacgcatcgtccgcatgcgcaaggaggtgccggagatcggctggggc
gatttcgcggtcattgcgacgcgtgatccggccgtcttcatcatgcgctatgactggcgc
aacaattcggtgctgttcgtgcacaatctcgatgagaagccacgcgagatcgcgttctcg
acggggctgcctgatgatgccggcgcgcacctgatcaatctgctcgcggaagaccacagc
cacgccgacaagcgcggccagcaccgcgtcgtgctggagccgtatggctatcgctggtat
cgggtcggcgggttggattatctcttgaagcggagcgatatcgacggggatactgcgggt
aacaagcatccggggtag

DBGET integrated database retrieval system