KEGG   Bradyrhizobium diazoefficiens USDA 110: bll3638Help
Entry
bll3638           CDS       T00109                                 

Definition
(RefSeq) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00061  Fatty acid biosynthesis
bja00620  Pyruvate metabolism
bja00640  Propanoate metabolism
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01120  Microbial metabolism in diverse environments
bja01130  Biosynthesis of antibiotics
bja01200  Carbon metabolism
bja01212  Fatty acid metabolism
Module
bja_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    bll3638
   00640 Propanoate metabolism
    bll3638
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    bll3638
Enzymes [BR:bja01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     bll3638
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     bll3638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 LAL_C2 GARS_A
Motif
Other DBs
NCBI-GeneID: 1048033
NCBI-ProteinID: NP_770278
RhizoBase: bll3638
UniProt: Q89P45
LinkDB All DBs
Position
complement(4023356..4024711)
Genome map
AA seq 451 aa AA seqDB search
MFDKVLIANRGEIALRIQRACRAMGLKTVVIHSEADRDARYVALADEALCIGPAPASSTY
LNVAAILLAVEVSGAQAIHPGYGFLSESAEFADRVARAGLAFIGPPADCIRTMGDKVAAK
RAMRLAGVPCVPGPDSALPEDPSEVHAIARDIGYPVIIKAAGGGGGRGMRIVRSEGALDD
ALALTRAEASKAFKNAAVYIEKFLEKPRHIEIQVLCDQHDNHLWLGDRDCSLQRRNQKVV
EEAPAPGIDRALIERVGASCVEACRRIGYRGAGTFEFLYENGQFFFIEMNTRVQVEHPVT
EATTGIDIVKAQIRIAQGEPLGIAQGDIARVGHAIEFRINAEDPTTFAPSPGMVTRWDVP
GGIGIRVDSHITAGATVPRHYDSLIGKLIAHGGSREEAMARARVALSELRAEGIRTNVPL
HQAILADPAFCRGGYDIHHLEHWMNARAAAP
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacaaggtcctgatcgccaaccggggcgagatcgcgcttcgcatccagcgcgcc
tgtcgggcgatgggtctcaagacggtcgtcattcactcggaggcggatcgcgacgcacgc
tatgtcgcactcgccgatgaggcactctgcatcgggccggcgccggcaagcagcacctat
ctcaacgttgcggcgatcctgctcgcagtcgaggtcagcggcgcccaggcgatccacccg
ggttacggattcctctcggagagtgcggagttcgccgatcgggtcgcgcgcgccggcctc
gccttcatcggcccgccggcggattgtattcggaccatgggcgacaaggtcgcggccaag
cgcgcgatgcggctggcgggcgtgccttgcgtgcccgggccggacagcgccctgccggag
gatccgtccgaggtgcacgcgatcgcgcgggacatcggataccccgtcatcatcaaggcc
gccggaggcggcggcggacgcggcatgcggatcgtgcgcagcgaaggcgcgctagacgac
gcgctggcgctgacccgcgcggaagccagcaaggccttcaagaacgctgcggtctacatc
gagaaattcctcgaaaagccccgccatatcgagattcaagtgttgtgcgatcagcatgac
aatcatctctggctcggcgaccgcgactgctcgcttcagcgcaggaaccagaaggtggtc
gaggaagcccccgcgcccggcatcgatcgcgctctgatcgagcgggtgggcgcaagctgc
gtcgaagcctgccggcggatcggctatcgcggcgccggcacattcgaattcctctacgag
aacggccaattcttcttcatcgaaatgaacacgcgcgtccaggtggagcatcccgtcacc
gaggccacgacggggatcgacatcgtcaaggcgcagatccgcatcgcgcaaggcgagccg
ttgggcatcgcgcaaggcgacatcgcacgtgtaggccatgccattgaattccgcatcaat
gccgaagaccccaccaccttcgctccctcgcccggcatggtgacgcgctgggatgttccc
ggcggcatcggcatccgcgtcgattcgcatatcaccgccggcgccaccgttccccggcac
tatgactcgctgatcggcaagctcatcgctcatggtggcagccgcgaggaagctatggcg
cgtgcgcgcgtcgccttgtccgagctacgcgccgaaggcatccgaaccaatgtgccgttg
catcaggcgatcctcgccgatcccgcgttttgccgtggcggctacgacatccaccatctc
gagcactggatgaatgcgcgggcggccgcgccatga

DBGET integrated database retrieval system