KEGG   Bradyrhizobium diazoefficiens USDA 110: bll4065Help
Entry
bll4065           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
KEGG Orthology (KO) [BR:bja00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    bll4065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-GeneID: 1051668
NCBI-ProteinID: NP_770705
RhizoBase: bll4065
UniProt: Q89MX7
LinkDB All DBs
Position
complement(4499439..4500086)
Genome map
AA seq 215 aa AA seqDB search
MLMPVLVYAYGPKEAVPIMAVASVMANFSRILAWWREVDWRACAAYSVTGVPAAALGART
LLALPSHTVDLAIGIFLIAMVPVRHWLARHDLKANLWHLAIGGAVIGYLTGIVVSTGPLS
VPLFLFYGLSKGAFLATEAAASLGLYFAKSVTFERFGALTSDVFIKGLIAGSSLMAGAFI
AKRFVLHLKPEMFRLLMDAIMIAAGLSMFWNATQP
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgccggtgctggtctacgcctatgggccgaaggaagccgtgccgatcatggcg
gtcgcctccgtcatggcgaatttctcgcggatcctggcctggtggcgcgaggtcgactgg
cgggcctgcgcggcctattcggtgacgggtgttccggccgcagcgcttggcgcgcgcacg
ctgctcgcgctcccctcccacaccgtcgatcttgccatcggcatcttcctgatcgcaatg
gtgccggtccggcactggctggcgcggcacgacctcaaggccaatctctggcatcttgcg
atcggcggcgccgtcatcggctatctcaccggcatcgtggtctcgaccgggccgctcagc
gtgccgctgttcctgttctacggcctctccaagggcgcattcctcgccaccgaggcggcc
gcctcgctcggcctctacttcgcgaagtccgtgaccttcgagcgcttcggcgcactgacg
agcgatgtgttcatcaaaggtctgatcgcaggatcgtcattgatggccggcgccttcatc
gcaaagcgtttcgtgctgcatctgaagcccgagatgttccgcctgctgatggacgcgatc
atgatcgcagccgggctctcgatgttctggaacgcgacacagccgtag

DBGET integrated database retrieval system