KEGG   Bradyrhizobium diazoefficiens USDA 110: bll4779Help
Entry
bll4779           CDS       T00109                                 

Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00010  Glycolysis / Gluconeogenesis
bja00020  Citrate cycle (TCA cycle)
bja00620  Pyruvate metabolism
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01120  Microbial metabolism in diverse environments
bja01130  Biosynthesis of antibiotics
bja01200  Carbon metabolism
Module
bja_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bll4779
   00020 Citrate cycle (TCA cycle)
    bll4779
   00620 Pyruvate metabolism
    bll4779
Enzymes [BR:bja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     bll4779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N GCV_H HlyD_2 ATP-synt_ab_Xtn Fas_alpha_ACP
Motif
Other DBs
NCBI-GeneID: 1052251
NCBI-ProteinID: NP_771419
RhizoBase: bll4779
UniProt: Q89KX1
LinkDB All DBs
Position
complement(5295031..5296386)
Genome map
AA seq 451 aa AA seqDB search
MPINILMPALSPTMEKGNLAKWLKKEGDKVKSGDVIAEIETDKATMEVEAIDEGTIAKIL
VPEGTQDVPVNDVIAVLAGEGEDVKAAGAAKPSASAAPPKATDAPAAAPAPATAPAAPKA
APPPAAAPAPQAAAPAAQSNGHGGRVFSSPLARRLAKDAGIDVSMVTGTGPHGRVVARDV
EQAKSGKGLKAPAAAPSSAPSIAPTMSDKQILSLFEPGSYDIVPHDGMRRTIAQRLTASI
QNVPHFYLTIDCDIGKLLAAREEINAAAPKDKEKKPLYKISVNDFVIKAMAVALQKIPNC
NVSWTESGMVKHHHSDVGVAVAMPGGLITPIIRKAETKTLSTISNEMKDFAARARSRKLK
PEEYQGGTTAVSNLGMYGISHFTAVINPPHATILAVGTSEERPVVRNGKIEIAHMMSVTL
SCDHRAIDGALGAELIGAFKQLIENPVMMMV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcaacatcctgatgcccgctctctcgccgacgatggagaagggcaacctcgcc
aagtggctgaagaaggaaggcgacaaggtcaaatccggcgatgtcatcgccgagatcgag
accgacaaggcgaccatggaggtcgaggccatcgacgagggcacgatcgccaagatcctg
gtgcccgaaggcacgcaggacgtcccggtcaacgacgtcatcgccgtgctggccggtgag
ggcgaggatgtgaaggccgctggtgccgccaagcccagcgcctccgccgcgccgccgaaa
gccacggatgctcccgctgctgcgccagctcccgcgacagcacctgctgcgcccaaggct
gcaccgccgcccgccgccgcacccgcgccgcaggctgccgcaccggctgctcagagcaac
ggccatggcggccgcgtgttctcatcgccgctggcgcgacgtctggccaaggacgccggc
atcgacgtgtcgatggtgacaggcaccggcccgcacggccgcgtcgtcgcccgcgacgtc
gagcaggccaagtccggcaagggcctcaaggcgcccgccgcggcgccgtcatccgcgccc
tcgatcgcgccgaccatgtcggacaagcagatcctgtcgctgttcgagcccggctcctac
gacatcgtcccgcacgacggcatgcgccgcacgatcgcgcagcgcctgactgcgtcgatc
cagaacgtcccgcatttctacctcaccatcgactgcgacatcggcaagctgctcgccgcg
cgcgaggagatcaatgcggcggctcccaaggacaaggagaagaagccgctctacaagatc
tcggtcaacgacttcgtcatcaaggcgatggcggtcgcgctccagaagatcccgaactgc
aatgtgagctggaccgaaagcggcatggtcaagcatcaccattccgacgtcggcgttgcc
gtggcgatgcccggtggcctgatcacgccgatcatccggaaagcggagaccaagacgctc
tccaccatctccaacgagatgaaggactttgccgcgcgcgcccgctcgcgcaagctcaag
cccgaggaataccagggcggcaccaccgccgtgtccaacctcggcatgtacggcatcagc
cacttcaccgccgtgatcaacccgccgcatgccaccatcctcgcggtcggcaccagcgaa
gaacggcccgtggtgcggaatggcaagatcgagatcgcgcacatgatgagcgtgaccttg
tcgtgcgatcaccgcgccatcgacggcgcgctcggcgccgagctgatcggcgcgttcaag
cagctcatcgaaaatccggtcatgatgatggtctga

DBGET integrated database retrieval system