KEGG   Bradyrhizobium diazoefficiens USDA 110: bll6599Help
Entry
bll6599           CDS       T00109                                 

Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00473  D-Alanine metabolism
bja00550  Peptidoglycan biosynthesis
bja01100  Metabolic pathways
bja01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    bll6599
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    bll6599
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    bll6599
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bja01011]
    bll6599
Enzymes [BR:bja01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     bll6599
Peptidoglycan biosynthesis and degradation proteins [BR:bja01011]
 Precursor biosynthesis
  Amino acid ligase
   bll6599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 Amidase02_C
Motif
Other DBs
NCBI-GeneID: 1051158
NCBI-ProteinID: NP_773239
RhizoBase: bll6599
UniProt: Q89FV0
LinkDB All DBs
Position
complement(7270129..7271121)
Genome map
AA seq 330 aa AA seqDB search
MNMRITILFGGSNRERLVSVASAQALHQALPEADLWWWDVEDRVHVVQSKQLLEHARPFE
DEFKPGTSGIPLVQALDQAKAEDRVLVLGLHGGCAENGELQVMCEARGVPFTGSGSASSH
LAFDKIAAKHFAALGGVTPPANIALDDIDAAFAEYGRLIAKPARDGSSYGLIFVNARQDL
VAVRNAAKHEEYVIEPYIAGVEATCGVLERTDGSIVSLPPIEIIPGEGNFDYAAKYLLST
TQEICPGRFTPEITAALKQQAMLAHRAMSCTGYSRSDFIVSAKGLVYLETNTLPGLTKSS
LYPKALKAEGIAFVDFLRGLVELAGRGVRK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcgcatcaccatcctcttcggcggctccaaccgggagcgtctggtttcggtt
gcctcggcccaggcgctgcatcaggcgctgcccgaggccgatctgtggtggtgggacgtc
gaggacagggtgcatgtcgtgcagtcgaagcagctgctcgaacatgcccgtccgttcgag
gacgagttcaagcccggcacatcaggcattccgctggtgcaggcgctcgaccaggccaag
gcggaagatcgcgtgctggtgctcggcctgcatggcggatgtgccgagaacggcgaattg
caggtgatgtgcgaggcgcgcggcgtgccgttcaccggttcgggctcggcctcctcgcat
ctcgccttcgacaagatcgcggccaagcatttcgccgcgctcggcggcgtgacgccgccc
gcaaacatcgcgctggacgatatcgacgcggccttcgccgaatacggccggctgatcgca
aagccggcgcgggacgggtcgagctatggcctgatcttcgtcaacgccaggcaggacctc
gtcgccgtccgcaatgccgcgaagcacgaggagtatgtgatcgagccctatatcgccggc
gtcgaggcgacctgcggcgtgctggagcgcaccgacggctcgatcgtctcgctgccgccg
atcgagatcattccgggcgagggcaatttcgactacgccgcaaagtaccttctgtcgacg
acgcaggagatctgccccggccgtttcacgcccgagatcaccgccgcgctgaagcagcag
gcgatgctggcgcaccgggcgatgtcctgcaccggctattcccgctcggacttcatcgtc
tcggccaaggggctcgtctatctcgaaaccaacacgctccccgggttgaccaagtcctcg
ctctaccccaaggcgctgaaggccgagggcatcgcgttcgtcgacttcctgcgcggcctg
gtcgagctcgccgggcggggtgtacggaaataa

DBGET integrated database retrieval system