KEGG   Bradyrhizobium diazoefficiens USDA 110: bll7859Help
Entry
bll7859           CDS       T00109                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    bll7859
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bja02000]
    bll7859
Enzymes [BR:bja01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     bll7859
Transporters [BR:bja02000]
 Other Transporters
  Pores ion channels [TC:1]
   bll7859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 1049682
NCBI-ProteinID: NP_774499
RhizoBase: bll7859
UniProt: Q89CD8
LinkDB All DBs
Position
complement(8612033..8612677)
Genome map
AA seq 214 aa AA seqDB search
MTDPNRITLYYSPQSRATGTRVLLEELGAPYDLHVLNMKAGEQRQGAYLAINPLGKVPAI
RHGDALVTEQVAITIYLGDLFPQAGLTPALDDPLRGPYLRWIAYYGASFEPALIDKFMQR
EPAPITQSPYADYDTMLGALEAQLSKGPYLLGERMTAADVLWGVAFSWTMMFGIVPKKDV
FVRYAERMTSRPAFQRINAADDEMAAQHAAAAVG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatccgaaccgcatcacgctgtattactcgccgcaaagccgcgccaccggcacg
cgggtgctgctggaggagttgggggcgccctacgatctccatgtcctcaacatgaaggcc
ggcgagcagcggcagggcgcctatctcgcgatcaacccgctcggcaaggtgccggcgatc
cgccacggcgatgcgctggtgaccgagcaggtcgccatcaccatttatctcggcgacctg
tttccgcaggcgggattgacgcccgcgctggacgatccgctgcgcggcccctatctgcgc
tggatcgcctattacggcgcatcgttcgagccggctttaatcgacaagttcatgcagcgc
gagccggcaccgatcacgcagtcgccctatgccgattacgacaccatgctgggtgcgctc
gaggcgcaattgtcgaaggggccgtatctgctcggcgagcgcatgacagcagcagacgtg
ctatggggcgtcgcgttcagctggacgatgatgttcggcatcgtgccgaaaaaggacgtc
ttcgtccgctatgccgagcggatgacgtcacggcccgcgttccagcggatcaatgcggcg
gatgacgagatggcggcgcagcatgctgcggctgctgtcggttga

DBGET integrated database retrieval system