KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2436Help
Entry
blr2436           CDS       T00109                                 

Gene name
glpD
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00564  Glycerophospholipid metabolism
bja01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    blr2436 (glpD)
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     blr2436 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 1050520
NCBI-ProteinID: NP_769076
RhizoBase: blr2436
UniProt: Q89SG4
LinkDB All DBs
Position
2653541..2655091
Genome map
AA seq 516 aa AA seqDB search
MRLLERIFDLAIIGGGVNGCGIARDAVGRGNTVFLCEMNDLASGTSSWSTKLVHGGLRYL
EYYEFRLVREALIEREILWGIAPHIIRPLRFVLPHHAGLRPAWLLRLGLFLYDHIGGRHL
LPATRSVDLGRDEVGRPLIPNRYSRAFEYSDCFVDDARLVVLNARDAADKGAEIRTRTRA
TEIRQADGVWTVSMVNTLTGARSQVQARALVNAGGPWVEDVLGRGAGVNAKAKVRLVQGS
HIVVKKLYDHDRAYMFQNADGRIIFVIPYQDDFTLIGTTDRDYDGDPAKVKATPEEIQYL
CAAASEYLAKPVTSEDVVWTYSGVRPLYDDGASEAKAATRDYVFELDTPGGSPLLSIYGG
KITTYRRLAEEALERLSPYLRSAKAREGWTGKWPLPGGDMDVSDIDGLIAELQRGYPFLG
HAHARRLARAYGTRAIKLLGDAKSAADLGQAFGATLTEREVRYLMANEWAVTAEDIVWRR
SKLGLRLSADEVAALDDWIRTNAVLQSPLLEAGGRS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgttggagcgtattttcgacctcgccattatcggaggcggtgttaacggctgt
ggcatcgcgcgcgacgcggtgggccgcggcaacacggttttcctgtgcgaaatgaacgat
ctggcgagcgggacgtcgtcctggtcgaccaagctggtgcatggcggcctgcgctatctc
gaatattacgagtttcgcctggtccgcgaggcgttgatcgaacgcgagatcctctggggc
atcgcgccccacatcatccgccccttgcgtttcgttttgccgcatcacgcagggctgcgc
ccggcctggctgctgcgcctcggcctgttcctctatgaccacatcggcggccgccatctg
ctgccggcgacccgttcggtcgatcttgggcgtgacgaggtcggccgcccgctgatcccg
aatcgctacagccgcgccttcgaatattccgactgcttcgtcgacgacgcccgcctcgtc
gtgctcaacgcgcgcgatgccgccgacaagggcgccgagatccgcactcgcacccgtgcc
accgagatccgccaggccgacggcgtatggacggtcagcatggtcaacacgctgaccggt
gcgcgctcgcaggtccaggcccgcgcgctggtcaatgccggcggcccctgggtcgaggac
gtgctcggccgcggagccggcgtcaacgcaaaagccaaggtgcgcctggtgcagggctcg
catatcgtggtcaagaagctctacgaccacgaccgtgcctacatgttccagaatgcggac
ggccgcatcatcttcgtgatcccgtaccaggacgatttcacgctgatcggcaccaccgac
cgcgactatgacggcgatcccgccaaggtgaaggcgacgccggaggagatccagtatctc
tgcgccgccgcgagcgaatatctggcgaagccggtgacttcagaggacgtggtctggacc
tattccggcgtgcggccgctctatgacgatggcgccagcgaagccaaggccgcaacgcgc
gactacgtgttcgagctcgacacgcccggcggctcgccgctgctctcgatctatggcggc
aagatcacgacctaccgccgcctcgccgaggaggcgctggagcggctttcgccctatctt
cgcagcgcgaaagcgcgcgagggctggaccgggaaatggccgcttcccggtggcgacatg
gatgtgtccgacatcgacgggctgatcgccgagctccagcgcggctatcccttcctcggc
catgcgcatgcgcgccgcctcgcgcgcgcctatggcacccgtgcgatcaagctgcttggc
gatgcgaaatcggccgccgacctcggccaggccttcggcgcgacgctcaccgagcgcgag
gtccgctatctcatggccaacgaatgggcggttaccgccgaggatatcgtctggcgccgt
tccaagctcggcctgcgactatctgccgacgaggtcgctgcgcttgacgactggatcagg
accaacgccgtgctgcaaagtcccctgctggaagcgggaggacgctcatga

DBGET integrated database retrieval system