KEGG   Bradyrhizobium diazoefficiens USDA 110: blr2585Help
Entry
blr2585           CDS       T00109                                 

Gene name
rbcL
Definition
(RefSeq) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00630  Glyoxylate and dicarboxylate metabolism
bja00710  Carbon fixation in photosynthetic organisms
bja01100  Metabolic pathways
bja01120  Microbial metabolism in diverse environments
bja01200  Carbon metabolism
Module
bja_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bja_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    blr2585 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    blr2585 (rbcL)
Enzymes [BR:bja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     blr2585 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 1049510
NCBI-ProteinID: NP_769225
RhizoBase: blr2585
UniProt: Q9ZI34
LinkDB All DBs
Position
2828304..2829764
Genome map
AA seq 486 aa AA seqDB search
MNAHTGTVRGKERYRSGVMEYKRMGYWEPDYTPKDTDVIALFRVTPQEGVDPIEASAAVA
GESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPGTPGSYFAYIAYDLDLFEPGSIANLSA
SIIGNVFGFKPLKALRLEDMRFPVAYVKTFQGPATGIVVERERLDKFGRPLLGATVKPKL
GLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRDRFLYCIEAVNRAQAASGEVKGT
YLNITAGTMEDMYERAEFAKELGSCIVMIDLVIGYTAIQSMAKWARRNDMILHLHRAGHS
TYTRQKSHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPNTTRGYYDVCREDFNPTKLE
HGLFFDQSWASLNKMMPVASGGIHAGQMHQLLDLLGEDVVLQFGGGTIGHPMGIAAGAIA
NRVALEAMILARNEGRDYVHEGPEILAKAAQTCTPLKSALEVWKDVTFNYQSTDTPDFVP
TALETV
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacataccggcacggttcgcggcaaggagcgttatcgctcgggcgtcatggaa
tacaagcgcatgggctattgggagcccgactacacgccaaaggacaccgacgtcatcgcg
ctgttccgcgtcacgcctcaggagggcgtcgatccgatcgaggcgtccgctgcggttgcc
ggcgagtcctcgaccgcgacctggacggtggtgtggacagatcgcctgacggccgcggag
aaatatcgcgcgaaatgctatcgcgtcgatccggtgccgggcacgccgggctcgtatttc
gcctacatcgcctacgacctcgacctgttcgagccgggctcgatcgccaacctctcggcc
tcgatcatcggcaacgtgttcggcttcaagccgttgaaggcgctgcggctcgaggacatg
cgattccccgtcgcctatgtgaagacgttccaggggccggcgaccggcatcgtggtcgag
cgcgagcgactcgacaagttcggccggccgctgctcggcgcaaccgtgaagccgaagctc
gggctttcggggcgtaactatggccgcgtggtctacgaggcgctgaagggcgggctcgac
ttcaccaaggacgacgagaacatcaactcgcagcccttcatgcattggcgcgaccgcttc
ctctattgcattgaggccgtgaaccgcgcacaggcggcgtcgggcgaggtgaagggcacg
tacctcaacatcaccgcgggaacgatggaggacatgtacgagcgtgcggagttcgcgaag
gagctcggatcctgcatcgtcatgatcgacctcgtgatcggctacaccgcgatccagtcg
atggccaagtgggcccggcgcaatgacatgatcctgcatctgcatcgcgccggccactcg
acctatacgcggcagaagagccatggcgtgtcgttccgtgtcatcgccaaatggatgcgg
ctcgccggggtagatcacatccatgccggcacggtggtcggcaagctcgaaggcgatccc
aacaccacgcgtggctactacgatgtctgccgcgaggatttcaatccgaccaagctcgag
cacggcctgttcttcgaccagtcctgggcgagcctgaacaagatgatgccggtggcctcc
ggcggcatccatgccggccagatgcaccagctgctcgatctgttgggcgaggacgtcgtg
ctgcaattcggcggtggcacgatcggccatcccatggggatcgcggccggcgcgatcgcc
aaccgcgtggcgctggaagcgatgatcctcgcccgcaacgaggggcgcgactacgtccac
gaaggcccggagatcctggccaaggcggcccagacctgcacgccgctcaagtccgcgctc
gaggtctggaaggacgtgaccttcaactaccagtccaccgacacgccggacttcgtgcca
acggcgctggaaaccgtttga

DBGET integrated database retrieval system