KEGG   Bradyrhizobium japonicum E109: RN69_03815Help
Entry
RN69_03815        CDS       T03509                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bjp  Bradyrhizobium japonicum E109
Pathway
bjp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bjp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RN69_03815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bjp02000]
    RN69_03815
Enzymes [BR:bjp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RN69_03815
Transporters [BR:bjp02000]
 Other Transporters
  Pores ion channels [TC:1]
   RN69_03815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_C_5 Tom37
Motif
Other DBs
NCBI-ProteinID: AJA59638
LinkDB All DBs
Position
complement(812752..813348)
Genome map
AA seq 198 aa AA seqDB search
MIKLYWSPRSRSFTTLWLMEESGLPYERVLTDISTGAQKAPDYLKVNPMGKVPALSDGDA
ALGEAAAICAYIADRYPEAKLAPAVTDPRRARYLQWLFFSPGCIEPAIIQIFTKIEIPTS
TAAWGSATQVFDVLEAALAKGPWILGEEFSAADVTVGSGLNFAVRLFKMVPSRPAFDAYL
ARCMARPAFQRAEQIAAG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctctattggtcgccacgctcgcgctcgttcacgacgctctggctgatggaa
gagagcggcctgccctatgagcgcgtgctgaccgacatctcgaccggtgcgcagaaagcg
ccggattatttgaaggttaatccgatgggcaaggtgccggcgctcagcgacggcgatgcc
gcgctcggcgaagccgctgcgatctgcgcctatatcgccgaccgctatcccgaagcgaag
ctcgcgcccgcggtaaccgatccgcgtcgtgcgcgctatctgcaatggctgttcttttcg
ccgggctgcatcgagcctgccatcatccagatcttcaccaagatcgagatcccgacctcg
acggcggcctggggcagcgccacgcaggtgttcgacgtgctggaagctgcgctcgcgaag
ggaccgtggattctcggcgaggaattttcggccgccgacgtcacggtcggctccggcctg
aacttcgcggtccgcctgttcaagatggtgccgtcacgcccggccttcgatgcctatctc
gcgcgctgcatggcgcggccggcgttccagcgggcggagcagatcgcggcggggtga

DBGET integrated database retrieval system