KEGG   Bradyrhizobium japonicum E109: RN69_04470Help
Entry
RN69_04470        CDS       T03509                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bjp  Bradyrhizobium japonicum E109
Pathway
bjp00500  Starch and sucrose metabolism
bjp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bjp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RN69_04470
Enzymes [BR:bjp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RN69_04470
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     RN69_04470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AJA59753
LinkDB All DBs
Position
complement(962259..963932)
Genome map
AA seq 557 aa AA seqDB search
MIDDLWYKNGVIYCLSVGTYMDANGDGVGDFKGLLRRLDYLHGLGITTIWLMPFQTSPGR
DDGYDIADYYSVDARYGTLGDFVEFTHGCKQRGIRVIIDLVVNHTSDQHHWFKEARRDKN
SPYRDWYVWSDKKPAGANKGMVFPGVQKSTWTRDKEAGAWFFHRFYDFQPDLNTSNPHVQ
AEILKIMGFWIQLGVSGFRMDAVPFVIATKGAKVKKPVEQYDMLRAFREFLQWRQGDAII
LAEANVRPETDMEYFGRDGDRMHMMFNFHVNQHLFYALASGDSRPLAKALKATRPRPASA
QWGLFLRNHDELDLGRLTKAQRDMVFKRFGPDKDMQLYDRGIRRRFAPMVGGDRRRLELA
YSLMCTLPGTPVIRYGDEIAMGDDLALPERNCARTPMQWSTEPHGGFTKSNKPACPVIDT
GPYGYEHVNVAKQRRDPNSMLNWTERIVRMRKEVPEIGWGDFAIIPTRDPAMFIMRYDWR
NNSVLFVHNLDEKPREIAFSAGLPGDAGARLINLLAEDHSHADKRGQHRVVLEPYGYRWY
RVGGLDYLLKRSDIETR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgatctctggtacaagaacggcgtgatctactgcctctccgtcggcacctat
atggatgccaacggcgacggcgtcggcgacttcaagggcctgctgcggcggctcgactat
ttgcacgggctcggcatcaccacgatctggctgatgccgttccagacctcgccgggccgc
gacgacggctacgacatcgccgactattacagcgtcgatgcccgctacggcacgctcggc
gatttcgtcgaattcacccatggctgcaagcagcgcggcatccgcgtcatcatcgacctc
gtcgtcaaccacacctccgaccagcaccactggttcaaggaggcgcgacgcgacaagaat
tcgccctaccgcgactggtacgtctggtcggacaagaagccggccggcgccaacaagggc
atggtgtttcccggcgtgcaaaaatcgacctggacgcgcgacaaggaagccggcgcctgg
ttcttccaccgcttctacgatttccagcccgatctcaacacctcgaacccgcatgtgcag
gccgagatcctgaagatcatgggcttctggatccagctcggcgtgtccggcttccgcatg
gacgccgttccgttcgtgatcgccaccaagggcgcaaaggtgaagaagccggtcgagcag
tacgacatgctgcgcgcgttccgcgaattcctgcaatggcggcagggcgacgccatcatc
ctcgccgaagccaacgtgcggcctgagacggacatggaatatttcggccgcgacggcgac
cgcatgcacatgatgttcaacttccacgtcaaccagcatctgttctatgcgctggcatcg
ggcgactcgcgtccgctggcgaaggcactgaaggcgaccaggccgcggccggccagcgcg
caatggggcctgttcctgcgcaatcacgacgaactcgatctcgggcggctgaccaaggca
cagcgcgacatggtgttcaagcgcttcggtcccgacaaggacatgcagctctacgatcgc
ggcattcgccgccgcttcgcgccgatggtcggcggcgaccgaaggcggctcgagctcgcc
tacagcctgatgtgcacgctgccggggacgcccgtcatccgctacggcgacgagatcgcg
atgggcgacgatctcgcgctccccgagcgcaattgcgcgcgcacgccgatgcaatggtcg
accgagccgcatggcggcttcaccaagagcaacaagcccgcatgcccggtcatcgacacg
ggcccctacggctacgagcacgtcaatgtcgcgaaacagcggcgcgatcccaattccatg
ctgaactggaccgagcgcatcgtccgcatgcgcaaggaggtgcccgagatcggctggggc
gacttcgcgatcattccgacgcgcgatcccgccatgttcatcatgcgctacgactggcgc
aacaattccgtgctgttcgtgcacaatctggatgagaagccgcgcgagatcgcgttctcg
gcgggactgcccggtgacgccggcgcgcgcctgatcaacctgctcgcggaggatcacagc
cacgccgacaagcgcggccagcatcgcgtcgtgctggagccctatggctatcgctggtac
cgggtcggcgggctggattatctgttgaagcggagtgatatcgagacgcgctag

DBGET integrated database retrieval system