KEGG   Bradyrhizobium japonicum E109: RN69_21855Help
Entry
RN69_21855        CDS       T03509                                 

Definition
(GenBank) phosphoesterase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
bjp  Bradyrhizobium japonicum E109
Brite
KEGG Orthology (KO) [BR:bjp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RN69_21855
Enzymes [BR:bjp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     RN69_21855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Methyltransf_25 ADH_N_assoc Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AJA62682
LinkDB All DBs
Position
complement(4611153..4612184)
Genome map
AA seq 343 aa AA seqDB search
MRAVVIHAPKDLRIDSYPDPAPAPGEVRVKIANGGICGSDLHYYHHGGFGVVRIQQPMAL
GHEIAGVVAAVGDGVTNVKPGARVAVNPSRPCGQCLHCQEGMRNQCLDMRFLGSAMRFPH
VQGGFREFITVDATQAVPIADKLSLAEAAVAEPLAVCLHAGKQAGPLLGKRVLITGCGPI
GALMILVSRFGGASEIVVTDVADAPLAVAKKLGATHAINVATDATALDPWRAGKGVFDTL
FEASGNQAALRTALDVLRPGATLVQLGLGGEMTLPINSIVAKELQLRGTFRFDPEFELAV
RLMGEGLIDVKPLITATMPFENAVAAFELASDRSQSMKVQLTF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgtcgtcatccacgccccgaaagacctgcggatcgacagctatcccgatcca
gcccccgccccgggcgaagtccgcgtcaagattgcgaacggcggcatctgcggctccgac
ctgcactactatcatcacggcggtttcggcgtcgtgcgcatccagcagccgatggcgctg
ggccacgagatcgcgggcgtggtcgcggccgtcggtgacggcgtcaccaatgtgaagccg
ggcgcgcgcgtcgccgtcaatccgagcagaccgtgcggccagtgcctgcattgccaggaa
ggcatgcgcaaccagtgcctcgacatgcgcttcctcggcagcgcgatgcgcttcccccat
gtccagggcggctttcgcgagttcatcacggtcgatgccacgcaagccgtgccgatcgct
gacaagctgtcgctggcggaagccgcagtggccgagccgctcgcagtgtgcctgcatgcc
ggcaagcaggccggccccctcctcggcaagcgcgtgctgatcacgggttgcgggccgatc
ggtgcgctgatgatcctggtctcgcgcttcggcggcgcgtccgagatcgtggtgaccgat
gtcgccgacgcgcctcttgcggtcgcaaagaagctcggcgccacccacgccatcaatgtc
gcgaccgatgccacagcgctcgatccctggcgcgccggcaagggcgtgttcgacaccctg
ttcgaggcctccggcaaccaggccgcgctccgcaccgcgctcgacgtgctccggcccggc
gcgacgctggtgcagctcggtctcggcggcgagatgacgctgccgatcaactccatcgtc
gccaaggaattgcagctccgcggcaccttccgcttcgaccccgaattcgagctcgcggtg
cggctgatgggcgaagggctgatcgacgtgaaaccgctgatcacggccaccatgccgttc
gagaacgctgtcgccgcgttcgaactcgccagcgaccgctcgcagtcgatgaaggtgcag
ctgacgttctag

DBGET integrated database retrieval system