KEGG   Bradyrhizobium japonicum E109: RN69_23690Help
Entry
RN69_23690        CDS       T03509                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bjp  Bradyrhizobium japonicum E109
Pathway
bjp00061  Fatty acid biosynthesis
bjp00780  Biotin metabolism
bjp01100  Metabolic pathways
bjp01212  Fatty acid metabolism
Module
bjp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bjp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RN69_23690
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RN69_23690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bjp01004]
    RN69_23690
Enzymes [BR:bjp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     RN69_23690
Lipid biosynthesis proteins [BR:bjp01004]
 Fatty acid synthase
  Component type
   RN69_23690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: AJA63000
UniProt: A0A4Y3YQD8
LinkDB All DBs
Position
4983045..4983506
Genome map
AA seq 153 aa AA seqDB search
MTEESPVKFELVDINAILRTLPHRFPMLLIDRVINIRADYSGIGIKNVTFNEPAFQGHFP
ERPVYPGVMMIEAMAQTAGVIGITSVEGTEKPRAVYFLTIDKCKFRKPVLPGDTIEYHMR
SIGRRKTMWWFHGDAKVNGQIVAEADVGAMLTD
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgacggaggaatcacctgttaaattcgagctggtggatatcaacgcgatcctccggacg
ctgccgcaccgtttcccgatgctgctgatcgaccgggtgatcaatatccgcgccgattac
agcggcattggcatcaagaacgtcaccttcaacgagccggccttccaggggcatttcccg
gaacgcccggtctatcccggcgtgatgatgatcgaagcaatggcgcagaccgcgggcgtg
atcggcatcacctcggtcgagggcaccgagaagccgcgcgcggtgtatttcctcaccatc
gacaaatgcaagttccgcaagccggtgctgcccggcgataccatcgaatatcacatgcgt
tcgatcggacgccgcaagacgatgtggtggtttcacggcgacgccaaggtcaacggccag
atcgttgcagaagccgacgttggcgccatgctgacggactga

DBGET integrated database retrieval system