KEGG   Bradyrhizobium japonicum E109: RN69_33035Help
Entry
RN69_33035        CDS       T03509                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bjp  Bradyrhizobium japonicum E109
Pathway
bjp00620  Pyruvate metabolism
bjp00680  Methane metabolism
bjp00710  Carbon fixation in photosynthetic organisms
bjp01100  Metabolic pathways
bjp01120  Microbial metabolism in diverse environments
bjp01200  Carbon metabolism
Module
bjp_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bjp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RN69_33035
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RN69_33035
   00680 Methane metabolism
    RN69_33035
Enzymes [BR:bjp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RN69_33035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJA64605
LinkDB All DBs
Position
complement(7018962..7021760)
Genome map
AA seq 932 aa AA seqDB search
MSLQTVPPDAIDNRANRAEDAQALEADARLRDDIRLLGRILGDTVRDQEGAELFDLVERI
RQTSIRFHRDEDRLARRELEQILDSMSTSETVRIVRAFSYFSHLANIAEDQNNIRQMRAR
SAAQSTGSGVLAETLAHARDAGIRPDVLRNFFKTALVSPVLTAHPTEVRRKSTMDREMEV
ASLLDRRERVALTADEAAASDEQLRREVLTLWQTNLLRRTKLTVLDEVANGLSFYDYTFL
REVPRLVNMLEDRLEEAGEAAASELASFLRMGSWIGGDRDGNPFVTADVMRGTLRLQSSR
VMQFYLNELHVLGSELSIAAHLADVSEELRTLAERSPDTSPHRSGEPYRLAVSGIYARLT
ATAEKLEVEITRRPVGKGRPYETVRELQADLDVLHRSLISNNARVIARGRLRLLRRAVDC
FGFHLARLDIRQNSAVHERTIAELMDAANPGMSYLALGEDARISLLTNELRSTRSLVSPF
VKYSDETMGELNVFHSAAEAHAKFGSDAIPQCIISMCKGMSDMLEVAVLLKEVGLVHPSG
RSAINIVPLFETIEDLQASSAIMDRMLSLHDYRRLVDSRGSVQEVMLGYSDSNKDGGFVT
SGWELYKAEIGLVDVFERHGVRLRLFHGRGGSVGRGGGPSYDAIIAQPGGAVNGQIRITE
QGEIISSKYSNAEVGRNNLEILAAATLEASLLHPRQSAPRREYLTAMDELSNLAFKAYRG
LVYETDGFVDYFWASTVINEIATLNIGSRPASRKKTRAIEDLRAIPWVFSWAQCRLMLPG
WYGFGSAVEQWIAEHPDKGMPFLKELYREWPFFRMLLSNMDMVLAKSSIAIASRYAELVP
DEALREKIFSRIRREWHSCIETLLDIMGQDRLLQGNPLLERSVRHRFPYLDPLNHVQVEL
LKEHRAQNPDEQVLRGIQLTINGISAGLRNTG
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgtccctccagaccgtgccacccgacgccattgacaaccgcgccaaccgcgccgaggac
gcccaggcgctggaggcagatgcgcggctgcgcgacgacatccgcctgctgggacgcatc
ctgggcgacacggtgcgcgaccaggaaggcgcggaattgttcgacctggtcgagcgcatc
cgccagacctcgatccggttccatcgcgacgaggaccggctcgcccgccgcgagctcgag
cagatcctcgacagcatgtcgacctcggagacggtgcggatcgtccgcgccttcagctat
ttctcccacctcgccaacatcgccgaggaccagaacaacattcgccagatgcgcgcccgc
agtgccgcccagagcaccggttccggcgtgctggcggagacgctggcccacgccagggat
gccgggatccgccccgatgtgctgcgcaatttcttcaagaccgcgctcgtcagcccggtc
ctgaccgcgcacccgaccgaggttcgccgcaagagcaccatggatcgcgaaatggaggtc
gctagcctgctggaccgccgcgagcgcgtcgcgctgaccgcggacgaggccgccgctagc
gacgaacagctccgccgcgaggtgctgacgctgtggcagaccaatctcttgcgccggacc
aagctcacggtgctcgacgaggtcgcgaacggcctgtcgttctacgattacaccttcctg
cgcgaggtgccgcggctggtcaacatgctcgaagaccggctggaggaggctggcgaggcg
gctgcaagcgagctcgcctcgttcctgcgcatgggcagctggatcggcggcgaccgcgac
ggcaatcccttcgtcaccgccgacgtgatgcgcgggacgctgcggctgcagtcgagccgg
gtgatgcaattctatctcaacgagctgcacgtgctcggctcggagctgtcgatcgcggcg
cacctcgccgacgtctccgaggagctgcggacgctggcggaacgctcgcccgacacctcg
ccgcaccggagcggcgagccttatcgtctcgcggtctccggcatctatgcgcggctgacc
gcgacggccgaaaagctcgaggtcgagatcacgcgccggccggtcggcaagggcaggcct
tacgagaccgtcagggagctgcaggccgatcttgacgtgctgcaccgttcgctgatctcc
aacaatgcccgcgtcatcgcccgcggccggctgcggctgctgcggcgcgcggtggactgc
ttcggcttccacctggcgcggctcgacatccgccagaactctgccgtgcacgagcgtacc
atcgccgagctgatggatgctgcgaaccccggcatgtcctatctcgcgctcggcgaggac
gcgcgcatctcgctgctcaccaacgagctgcgcagcacgcgctcgctggtctcgccattc
gtcaaatacagcgacgagaccatgggcgagctcaacgtcttccattccgccgcggaggcg
catgcgaagttcggctcggacgcgattccccaatgcatcatctcgatgtgcaagggcatg
tccgacatgctcgaagtggccgtgctgctcaaggaggtcggtctcgtccatccctccggg
cgcagcgccatcaacatcgtgcccctgttcgagaccatcgaggatttgcaggcatccagc
gccatcatggatcgcatgctgtcgctgcacgattaccgccgcctcgtcgacagccgcggc
agcgtacaggaggtcatgctcggctattccgacagcaacaaggatggcggcttcgtcacc
tcgggctgggagctctacaaggccgagatcggcctcgtcgacgtgttcgagcgccacggc
gtgcggctgcgcctgttccacggccgcggcggctcggtcggccgcggcggcggcccgagc
tatgatgccatcatcgcgcagcccggcggcgcggtgaacgggcagatccgcatcaccgag
cagggcgagatcatctcgtcgaaatattccaacgccgaagtcgggcgcaacaatctggag
atcctcgccgccgcgacgctggaggcgagcctgctgcatccgcgccagagcgcgccgcgc
cgcgaatatctcaccgcgatggacgagctttcaaatctggctttcaaggcctatcgcggc
ctcgtctacgagaccgatggtttcgtcgattatttctgggcctccaccgtcatcaacgag
atcgcgacgctgaacatcggcagccgtccggcctcgcgcaagaagacccgcgcgatcgag
gatctgcgcgccattccctgggtgttctcctgggcgcagtgccgcctgatgctgccgggc
tggtacggctttggcagcgcggtcgagcagtggatcgcggagcatcccgacaagggcatg
ccgttcctgaaggagctctacagggaatggccgttcttccgcatgctgctgtcgaacatg
gacatggtgctggcgaaaagctcgatcgcgatcgcctcgcgctatgccgagctcgtgccg
gacgaggccttgcgcgaaaagatcttcagccgcatccgtcgcgaatggcattcctgcatc
gagacgctgctcgacatcatgggccaggaccggttgctccagggtaacccgctgctggag
cgctcggtgcgccaccgcttcccctatctcgatccgctcaaccacgtgcaggtcgagctt
ttgaaggagcaccgcgcgcagaacccggacgagcaggtgctgcgcgggattcagctgacc
atcaacggcatctcggcggggttgaggaatacgggttga

DBGET integrated database retrieval system