KEGG   Bradyrhizobium japonicum E109: RN69_33770Help
Entry
RN69_33770        CDS       T03509                                 

Definition
(GenBank) bicarbonate ABC transporter permease
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
bjp  Bradyrhizobium japonicum E109
Pathway
bjp00910  Nitrogen metabolism
bjp02010  ABC transporters
Module
bjp_M00438  Nitrate/nitrite transport system
bjp_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:bjp00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    RN69_33770
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RN69_33770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bjp02000]
    RN69_33770
Transporters [BR:bjp02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    RN69_33770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AJA64733
LinkDB All DBs
Position
complement(7186404..7187300)
Genome map
AA seq 298 aa AA seqDB search
MNMPATKIEVETATLAGAAAPVVAMTPKRPPRSEAYARMARETAVRVIPPLVVIALLTLV
WELVCRRAGSALPPPSKVFKDTKELIFDPFFDHGGIDKGLFWHLSASLQRVALGYSLAAI
AGIGLGVLVGQSVWAMRGLDPLFQVLRTIPPLAWLPLSLAAFRDGQPSAIFVIFITSIWP
IIINTAVGIRNIPQDYRNVAAVVQLNPLEFFGKIMIPAAAPYIFTGLRIGIGLSWLAIIA
AEMLIGGVGIGFFIWDAWNSSHISEIILALFYVGIVGFVLDRLIAGLGKIVTRGTAQN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcctgccacgaagattgaggttgagactgcgacgcttgcgggcgctgccgcg
ccggtcgtcgcgatgacgccgaagcggccgccgcgcagcgaggcctacgcgcgtatggcg
agggagaccgccgtgcgcgtgattccgccgctggtcgtgatcgcgctgctgacactggtg
tgggagctagtctgccgccgcgccggctcggcgctgccgccgccgtcaaaggtgttcaag
gacaccaaggaattgatcttcgatccgttcttcgatcatggcggcatcgacaagggcctg
ttctggcatctctccgccagcctccagcgcgtcgcgctaggctactcgctcgccgccatc
gccggcatcgggctcggcgtgctggtcgggcagtcggtctgggcgatgcgcgggctcgat
ccgctgttccaggtgctgcgcaccatcccgccgctggcctggctgccgctgtcgctcgcg
gcgttccgcgacggccagccgtcggcgatcttcgtcatcttcatcacctcgatctggccg
atcatcatcaacaccgcggtcggtatccgcaacatcccgcaggactaccgcaacgtcgcc
gcggtggtgcagctcaatccgctcgagttcttcggcaagatcatgatcccggcggcggcg
ccctacatcttcacgggccttcgcatcggcatcggcctgtcctggctcgccatcatcgca
gccgaaatgctgatcggcggcgtcggcatcggcttcttcatctgggacgcctggaattcc
tcgcatatcagcgagatcatcctggcgctgttctatgtcggcatcgtcggcttcgtgctc
gaccgcctgatcgcgggcctcggcaagatcgtcacccgcggcacggcgcagaactga

DBGET integrated database retrieval system