KEGG   Bradyrhizobium japonicum E109: RN69_35015Help
Entry
RN69_35015        CDS       T03509                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bjp  Bradyrhizobium japonicum E109
Pathway
bjp00630  Glyoxylate and dicarboxylate metabolism
bjp00710  Carbon fixation in photosynthetic organisms
bjp01100  Metabolic pathways
bjp01120  Microbial metabolism in diverse environments
bjp01200  Carbon metabolism
Module
bjp_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bjp_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bjp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RN69_35015
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RN69_35015
Enzymes [BR:bjp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RN69_35015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AJA64934
LinkDB All DBs
Position
complement(7471814..7472221)
Genome map
AA seq 135 aa AA seqDB search
MKLTQGCFSFLPDLTDDQIYKQVQYCLTNGWAVNIEFTDDPHPRSTYWEMWGLPMFDLQD
AAGVMMELAECRRVYGDRYIRISGFDSSHGWESVRISFLVNRPPQEAEFELVRQEVGGRA
IRYTTVRRPAAHAST
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgacccagggctgcttctcgttcctgcctgatctgaccgacgaccagatctat
aagcaggtgcagtattgcctgaccaacggctgggcggtgaatatcgagttcaccgacgat
ccgcatccccgcagtacctattgggagatgtggggcctgccaatgttcgacctccaggac
gccgccggcgtgatgatggagctcgccgaatgccgcagggtttacggcgaccgctacatc
cgcatcagtggattcgactccagccatggctgggaatcggtgcggatctcgttcctcgtc
aaccgcccgccgcaggaagccgagttcgagctggtgcggcaggaggtgggcggacgtgcg
atccgctacaccaccgtgcgccggccggccgcgcacgcgtcgacgtag

DBGET integrated database retrieval system