KEGG   Bradyrhizobium japonicum E109: RN69_35020Help
Entry
RN69_35020        CDS       T03509                                 

Gene name
rbcL
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
bjp  Bradyrhizobium japonicum E109
Pathway
bjp00630  Glyoxylate and dicarboxylate metabolism
bjp00710  Carbon fixation in photosynthetic organisms
bjp01100  Metabolic pathways
bjp01120  Microbial metabolism in diverse environments
bjp01200  Carbon metabolism
Module
bjp_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bjp_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bjp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RN69_35020 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RN69_35020 (rbcL)
Enzymes [BR:bjp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RN69_35020 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AJA64935
LinkDB All DBs
Position
complement(7472233..7473693)
Genome map
AA seq 486 aa AA seqDB search
MNAHAGTVRGKERYRSGVMEYKRMGYWEPDYTPKDTDVIALFRVTPQEGVDPIEASAAVA
GESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPGTPGSYFAYIAYDLDLFEPGSIANLSA
SIIGNVFGFKPLKALRLEDMRFPVAYVKTFQGPATGIVVERERLDKFGRPLLGATVKPKL
GLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRDRFLYCMEAVNRAQAASGEVKGT
YLNVTAGTMEDMYERAEFAKELGSCIVMIDLVIGYTAIQSMAKWARRNDMILHLHRAGHS
TYTRQKSHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPNTTRGYYDVCREDFNPTKLE
HGLFFDQSWASLNKMMPVASGGIHAGQMHQLLDLLGEDVVLQFGGGTIGHPMGIAAGAIA
NRVALEAMILARNEGRDYVHEGPEILARAAETCTPLKAALEVWKDVTFNYESTDTPDFVP
TALETV
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacacgcaggaaccgtccggggcaaagagcgctatcgatcaggcgtgatggaa
tacaagcgcatgggctattgggagcccgattacacgccgaaggacaccgacgtcatcgcg
ctgttccgcgtgacgccgcaggagggcgtggaccccatcgaggcgtcagcggcggttgcc
ggagaatcctcgaccgcgacctggacggtggtgtggactgatcgcctgaccgctgcggag
aagtatcgcgcaaagtgctaccgcgtcgatccggtgcccggcacgccgggctcgtatttc
gcctacatcgcctacgacctcgacctgttcgagccgggttcgatcgccaacctgtcggcc
tcgatcatcggcaacgtgttcggcttcaagccgctgaaggcgctgcgtctggaagacatg
cgcttcccggtcgcctatgtgaagacgttccaggggccggcgaccggcatcgtggtcgag
cgtgagcggctcgacaagttcgggcggccgctgctgggcgcgacggtgaagccgaagctc
ggcttgtccgggcgcaactatggccgcgtggtttacgaggcgctcaagggcgggctcgac
ttcaccaaggacgacgagaacatcaactcgcagcccttcatgcattggcgtgaccgcttc
ctctattgcatggaggccgtgaaccgcgcgcaggcggcgtccggcgaggtcaagggcacc
tacctgaacgtcaccgcggggacgatggaggacatgtatgagcgcgcggagttcgcgaaa
gagctcgggtcgtgcatcgtgatgatcgatctcgtgatcggctacaccgcgatccagtcc
atggcgaaatgggcgcggcgcaacgacatgatcctgcatctgcatcgcgccggtcactcg
acctatacgcggcagaagagccacggcgtgtcgttccgcgtcatcgcgaagtggatgcgg
ctcgccggcgtcgaccacatccatgccggcacggtggtcggcaagctcgaaggcgatccc
aacaccacgcgcggctattacgacgtctgccgcgaagacttcaacccgaccaagctcgag
catggcctgttcttcgaccagtcctgggcgagcctcaacaagatgatgccggtcgcctcc
ggcggcatccatgccggccagatgcaccagctgctcgacctcctcggcgaggacgtcgtg
ctgcaattcggcggcggcaccatcggccatcccatgggcattgcggccggtgcgatcgcc
aaccgcgtggcgctcgaagcgatgatcctcgcccgcaacgaggggcgcgactacgtccat
gaaggtccggagatcctggccagggcggccgagacctgcacgccgctgaaggctgcgctc
gaggtctggaaggacgtcaccttcaactatgaatccaccgacacgccggacttcgtgccg
accgcgctggaaaccgtttga

DBGET integrated database retrieval system