KEGG   Bradyrhizobium japonicum E109: RN69_35875Help
Entry
RN69_35875        CDS       T03509                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bjp  Bradyrhizobium japonicum E109
Pathway
bjp00564  Glycerophospholipid metabolism
bjp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bjp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    RN69_35875
Enzymes [BR:bjp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RN69_35875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AJA65081
LinkDB All DBs
Position
complement(7662354..7663904)
Genome map
AA seq 516 aa AA seqDB search
MRLLERIFDLAIIGGGVNGCGIARDAVGRGNTVFLCEMNDLASGTSSWSTKLVHGGLRYL
EYYEFRLVREALIEREILWGIAPHIIRPLRFVLPHHAGLRPAWLLRLGLFLYDHIGGRHL
LPATRSVDLRRDEVGRPLIPNRYSRAFEYSDCFVDDARLVVLNARDAADKGAEIRTRTRA
TDIKQSGGIWTVGMVNTLTGERSSIQARALVNAGGPWVEDVLGRGAGVNTKAKVRLVQGS
HIVVKKLYDHDRAYMFQNADGRIIFVIPYQDDFTLIGTTDRDYDGDPAKVKATPEEIEYL
CAAASEYLAKPVTSADVVWTYSGVRPLYDDGASEAKAATRDYVFELDTPGGVPLLSIYGG
KITTYRRLAEEALERLAPYLRSAKAREGWTGKWPLPGGDMGVSDVDGLIAELQRGYPFLS
LEHARRLARAYGTRAIKLLGDAKSAADLGQAFGATLTEREVRYLMANEWAVTAEDIVWRR
SKLGLRLSADEIAALNDWIATHTVPQSPLLEAGGRP
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgttggagcgtattttcgacctcgccattatcggaggcggtgttaacggctgc
ggcatcgcgcgcgacgcggtgggccgtggcaacacggtcttcctgtgcgaaatgaacgat
ttggcgagcgggacctcgtcctggtcgaccaagctggtgcatggcggcctgcgctatctc
gaatattacgagtttcgcctggtccgcgaggcgctgatcgagcgcgagatcctctggggc
atcgcgccccatatcatccgtcccctgcgtttcgttttgccgcatcacgccggcctgcgt
ccggcctggctgctgcgcctcggcctcttcctctatgaccatatcggcggccggcacctg
ttgccggcgacgcgttcggtcgatctcaggcgcgacgaggttggccgtccgctgatcccg
aaccgctacagccgcgcgttcgaatattccgactgtttcgtcgacgacgcccgtctcgtc
gtgctcaacgcacgcgatgccgccgacaagggcgccgagatccgcacccgcacccgcgcg
acggatatcaagcagtccggcggcatctggaccgtcggcatggtcaacacgctgaccggc
gagcgctcttcgatccaggcccgcgcgctggtcaatgccggcggcccctgggtcgaggac
gtgctcggccgcggcgccggcgtcaacacgaaagccaaggtgcgcctggtgcagggctcg
cacatcgtggtcaagaaactctatgaccacgaccgcgcctacatgttccagaacgcggac
ggccgcatcatcttcgtgatcccgtaccaggacgactttacgctgatcggcaccaccgac
cgcgactacgacggcgatccagccaaggtgaaggcgacgcccgaagagatcgagtacctc
tgcgccgccgcgagcgagtatctggccaagccggtgacttcagcggacgtggtctggacc
tattccggcgtgcgaccgctctatgacgacggcgccagcgaagccaaggccgcgacgcgc
gactacgtgttcgagctcgacacacccggcggcgtgccgctgctctcgatctatggcggc
aagatcacgacctaccgccggctcgccgaagaggcgctggaacggctcgcaccctatctt
cgcagtgcgaaagcgcgcgaaggctggaccggcaaatggccgctgcccggcggcgacatg
ggcgtctccgacgtcgacggcctgatcgccgagctccagcgcggctatcccttcctcagc
ctcgagcacgcccggcgtctcgcccgcgcttacggcacccgcgccatcaagctgctcggc
gatgcgaaatcggcggccgatctcggccaggccttcggcgcgacgctgaccgagcgcgag
gtccgctacctcatggccaatgaatgggcggtcacggcggaagacatcgtctggcgccgc
tccaagcttggcctgcgactatctgccgacgagatcgctgcattgaacgactggattgca
acccacactgtgccgcaaagtcccctgctggaagcgggaggacgcccatga

DBGET integrated database retrieval system