KEGG   Bacillus sp. JS: MY9_0068Help
Entry
MY9_0068          CDS       T02027                                 

Definition
(GenBank) Hsp33-like chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
bjs  Bacillus sp. JS
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bjs03110]
    MY9_0068
Chaperones and folding catalysts [BR:bjs03110]
 Heat shock proteins
  HSP33
   MY9_0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AFI26608
UniProt: I0EZF2
LinkDB All DBs
Position
79936..80811
Genome map
AA seq 291 aa AA seqDB search
MDYLVKALAYDGKVRAYAARTTDMVNEGQRRHGTWPTASAALGRTMTASLMLGAMLKGED
KLTVKVEGGGPIGAIVADANAKGEVRAYVSNPQVHFDLNEQGKLDVRRAVGTSGTLSVVK
DLGLREFFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLM
PGTDDETITKIEQRLSQVEPISKLIQKGLTPEEILEEVLGEKPEILETMPVRFHCPCSKE
RFETAILGLGKKEIQDMIEEDGQAEAVCHFCNEKYLFTKEELEGLRDQTTR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggattatttagtaaaagcacttgcgtatgacggaaaagttcgggcttatgcagcgaga
acgactgatatggtaaatgaaggacagagacgccatggtacgtggccgacagcatccgct
gcattagggcgcacaatgacagcttcacttatgctcggcgctatgctgaaaggcgaagat
aagctgactgtgaaagtcgagggcggaggtccgattggagctattgtagctgatgccaat
gccaaaggagaagtcagagcctatgtctctaacccacaagttcatttcgatttaaatgaa
caaggcaagcttgatgtcagacgtgcggttggaacaagcggaacgttaagtgttgtaaaa
gatttaggtttgcgtgagttcttcacaggacaagtagaaatcgtttcaggagaattagga
gatgattttacttactatcttgtgtcatctgagcaggttccttcatcagtgggtgtaggc
gtgctcgtcaatcctgacaataccattcttgcggcagggggctttattattcagctgatg
ccgggaacagatgatgaaaccatcacaaaaattgaacagcgcctatctcaagttgagccg
atttctaagctcatccaaaagggattgacaccggaagaaattttagaagaagtcctaggc
gagaaaccagagattttggaaacgatgcctgtcagattccattgtccttgttcaaaagaa
cggttcgaaacagccattttaggactaggcaaaaaagaaattcaagatatgatagaagaa
gatggacaagccgaagcagtatgccatttttgtaatgaaaagtacttatttacaaaagaa
gagctggaagggcttcgtgaccaaactacccgctaa

DBGET integrated database retrieval system