KEGG   Bacillus sp. JS: MY9_0113Help
Entry
MY9_0113          CDS       T02027                                 

Definition
(GenBank) translation elongation factor Tu (EF-Tu)
  KO
K02358  elongation factor Tu
Organism
bjs  Bacillus sp. JS
Brite
KEGG Orthology (KO) [BR:bjs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bjs03012]
    MY9_0113
   03029 Mitochondrial biogenesis [BR:bjs03029]
    MY9_0113
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bjs04147]
    MY9_0113
Translation factors [BR:bjs03012]
 Eukaryotic Type
  Elongation factors
   MY9_0113
 Prokaryotic Type
   MY9_0113
Mitochondrial biogenesis [BR:bjs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MY9_0113
Exosome [BR:bjs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MY9_0113
  Exosomal proteins of breast cancer cells
   MY9_0113
  Exosomal proteins of colorectal cancer cells
   MY9_0113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW DLIC RsgA_GTPase Peptidase_U32_C
Motif
Other DBs
NCBI-ProteinID: AFI26653
UniProt: I0EZJ7
LinkDB All DBs
Position
132938..134128
Genome map
AA seq 396 aa AA seqDB search
MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAITTVLHKKSGKGTAMAYDQIDGAPEERER
GITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH
ILLSKNVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVIKGSALKAL
EGDAEYEAKIFELMDAVDEYIPTPERDTEKPFMMPVEDVFSITGRGTVATGRVERGQVKV
GDEVEIIGLQEENKKTTVTGVEMFRKLLDYAEAGDNIGALLRGVSREEIQRGQVLAKPGT
ITPHSKFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGIIHLPEGVEMVMPGDNTE
MNVELISTIAIEEGTRFSIREGGRTVGSGVVSTITE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaattcgaccgttccaaatcacatgccaatattggtacaattggacac
gttgaccatggtaaaacaactttaactgctgctatcacaacagtacttcataagaaatct
ggtaaaggtacagctatggcgtacgatcaaattgatggtgctccagaagaacgtgagcgc
ggtatcacaatctctactgcacacgttgagtacgaaactgaaactcgtcactatgcacac
gttgactgcccaggacacgctgactatgttaaaaacatgatcactggtgctgcgcaaatg
gacggagctatccttgtagtatctgctgctgatggcccaatgccacaaactcgtgagcac
atccttctttctaaaaacgttggtgtaccatacatcgttgtattcttaaacaaatgcgac
atggtagacgacgaagagcttcttgaactagttgaaatggaagttcgcgatcttcttagc
gaatacgacttccctggtgatgatgtaccagtaatcaaaggttctgctcttaaagctctt
gaaggtgacgctgagtacgaagctaaaatcttcgaacttatggatgcggttgatgagtac
atcccaactccagaacgcgacactgaaaaaccattcatgatgccagttgaggacgtattc
tcaatcactggtcgtggtacagtagcgactggccgtgtagaacgcggacaagttaaagtc
ggtgacgaagttgaaatcatcggtctacaagaagagaacaagaaaacaactgttacaggt
gttgaaatgttccgtaagcttcttgattatgctgaagctggtgacaacattggtgccctt
cttcgtggtgtatctcgtgaagaaatccaacgtggtcaagtacttgctaaaccaggtaca
atcactccacacagcaaattcaaagctgaagtttacgttctttctaaagaagagggtgga
cgtcacactccattcttctctaactaccgtcctcagttctacttccgtacaactgacgta
actggtatcatccatcttccagaaggcgtagaaatggttatgcctggagataacactgaa
atgaacgttgaacttatctctacaatcgctatcgaagaaggaactcgtttctctattcgt
gaaggcggacgtactgttggttcaggcgttgtttctacaatcactgagtaa

DBGET integrated database retrieval system